BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0190 (837 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 27 0.53 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 8.7 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 27.5 bits (58), Expect = 0.53 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -1 Query: 219 VLS*CPTHLELSGXRSEAPVAVPPLAINCRPHSDRLFANESRPV 88 VL CP +L+G R +APV +PP + DR+ E P+ Sbjct: 81 VLVCCPLVRKLTG-RFDAPVELPPPGECGKMQMDRIVGGEVAPI 123 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 8.7 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = -2 Query: 161 WRYRHWRSTAGHIPTDSLLTRVDPFCPKR*EELVFHLT 48 W+ R W +T T L+ + P+ +R + FH++ Sbjct: 859 WQ-REWSTTTSGSWTRRLIPNIQPWITRRHGNIEFHMS 895 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 750,525 Number of Sequences: 2352 Number of extensions: 14733 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88478514 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -