BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0189 (863 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-... 23 4.1 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 22 5.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.4 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 9.4 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 9.4 >AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-like protein protein. Length = 143 Score = 22.6 bits (46), Expect = 4.1 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 612 HGTIKQKDXHARTHD*PIYSYRXQSGXXRPTDLEELKVSTCLTLLYK 752 HG +K+K T ++ Y+ + R D+ +L ST T ++K Sbjct: 87 HGFLKEKAVDFLTILNSMHKYQPRFHLVRANDILKLPYSTFRTYVFK 133 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 7/30 (23%) Frame = +3 Query: 381 TGHIARNCPEGGR-------ESATQTCYNC 449 +G + NCP GG+ E+A + C +C Sbjct: 19 SGCLITNCPRGGKRSKFAISENAVKPCVSC 48 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -1 Query: 212 ESRDTTPPCVHSRAKCPVRLH 150 E R+ PP VHS P H Sbjct: 1790 EEREEAPPSVHSSTVVPPPQH 1810 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.4 bits (43), Expect = 9.4 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -2 Query: 631 FCFIVPCVGII 599 FC I+ C+G+I Sbjct: 74 FCIIIMCLGVI 84 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.4 bits (43), Expect = 9.4 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -2 Query: 631 FCFIVPCVGII 599 FC I+ C+G+I Sbjct: 74 FCIIIMCLGVI 84 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,145 Number of Sequences: 336 Number of extensions: 3825 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23789590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -