BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0189 (863 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 26 0.52 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 23 2.7 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 4.8 DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein ... 22 6.3 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 6.3 AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein ... 22 6.3 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 25.8 bits (54), Expect = 0.52 Identities = 10/33 (30%), Positives = 13/33 (39%) Frame = +3 Query: 357 PSCYNCNKTGHIARNCPEGGRESATQTCYNCNK 455 P C C H + CP+G + T N K Sbjct: 76 PICGACGDIAHTVKYCPKGTKNPGTLATVNAFK 108 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 23.4 bits (48), Expect = 2.7 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +3 Query: 498 VLRVGKPGHISRECDEARN*PQPPCLPYNQ 587 +LR G PGH ++ P P PYN+ Sbjct: 56 LLRQGVPGHHYGAAGSQQDMPYPRFPPYNR 85 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 22.6 bits (46), Expect = 4.8 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 276 NPSQSVLSVALEALLT 229 NPS V++VAL ALL+ Sbjct: 78 NPSNEVVAVALGALLS 93 >DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein 2 protein. Length = 117 Score = 22.2 bits (45), Expect = 6.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 434 LRRRLPPPLGTVPCD 390 LRR+L LG PCD Sbjct: 48 LRRQLKCALGEAPCD 62 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 22.2 bits (45), Expect = 6.3 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = +1 Query: 106 EFSKPIAMSSSVCYKCNRTGHFAR 177 + KP+ +V Y ++G+F+R Sbjct: 165 DIGKPVVAEETVDYMLEKSGNFSR 188 >AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein protein. Length = 117 Score = 22.2 bits (45), Expect = 6.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 434 LRRRLPPPLGTVPCD 390 LRR+L LG PCD Sbjct: 48 LRRQLKCALGEAPCD 62 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,689 Number of Sequences: 438 Number of extensions: 3944 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27916710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -