BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0187 (769 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY082691-1|AAL92482.1| 77|Apis mellifera preprosecapin protein. 23 2.4 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 4.1 >AY082691-1|AAL92482.1| 77|Apis mellifera preprosecapin protein. Length = 77 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +1 Query: 58 TVSLFIIK*YYIL*PSKCSTILPNSQPICSQGEQQLP 168 TV LF ++ PSKC + + QP+ ++ +P Sbjct: 13 TVLLFSFVVILLIIPSKCEAVSNDMQPLEARSADLVP 49 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +2 Query: 125 LILNQFARKENNSYLHTIRGHHSNHNEVSNCG 220 LI A N S + + G+H NH S G Sbjct: 332 LIDRWVANVPNGSVTNWVSGNHDNHRVASRFG 363 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,162 Number of Sequences: 438 Number of extensions: 4500 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -