BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0185 (841 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0574 - 4697425-4698312 28 8.1 03_05_0890 - 28547462-28547545,28548451-28548528,28548641-285488... 28 8.1 >12_01_0574 - 4697425-4698312 Length = 295 Score = 28.3 bits (60), Expect = 8.1 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 5/47 (10%) Frame = -2 Query: 219 TATLRHARGDYYFYIEILRNV-----RGDDAECYRAVCGQANHSQEL 94 TA LR D +++LR RGD A CY AV G+A ++L Sbjct: 112 TAGLRGRLQDLTAGVQVLRRQVSAERRGDAARCYLAVAGEAPTEEQL 158 >03_05_0890 - 28547462-28547545,28548451-28548528,28548641-28548814, 28548902-28548958,28549065-28549116,28549907-28549995, 28550259-28550344,28550427-28550637,28551790-28551882, 28551958-28552098,28552175-28552267,28553879-28554113, 28554263-28554435,28555234-28556571,28556668-28556853, 28557625-28557713,28557756-28557905,28557951-28558596 Length = 1324 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 373 CIS*TNALIALLNSTIYLAYLAILHVLHEDIKP 275 C+ A I L + L YL +H++H D+KP Sbjct: 1004 CLDEDVARIYLAEVVLALEYLHSMHIVHRDLKP 1036 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,218,101 Number of Sequences: 37544 Number of extensions: 349149 Number of successful extensions: 590 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 590 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2326952232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -