BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0185 (841 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g09620.1 68414.m01079 tRNA synthetase class I (I, L, M and V)... 29 3.8 >At1g09620.1 68414.m01079 tRNA synthetase class I (I, L, M and V) family protein similar to cytosolic leucyl-tRNA synthetase [Candida albicans] GI:9858190; contains Pfam profile PF00133: tRNA synthetases class I (I, L, M and V) Length = 1084 Score = 29.1 bits (62), Expect = 3.8 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = -1 Query: 346 ALLNSTIYLAYLAILHVLHEDIKPKGARRL 257 +L +S++Y+AY + H+ H+ KG++ L Sbjct: 596 SLSDSSLYMAYYTVAHIFHDGDMYKGSKSL 625 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,899,380 Number of Sequences: 28952 Number of extensions: 299171 Number of successful extensions: 476 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1941125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -