Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0176
         (764 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A3DC55 Cluster: Putative uncharacterized protein precur...    34   3.4  

>UniRef50_A3DC55 Cluster: Putative uncharacterized protein
           precursor; n=1; Clostridium thermocellum ATCC 27405|Rep:
           Putative uncharacterized protein precursor - Clostridium
           thermocellum (strain ATCC 27405 / DSM 1237)
          Length = 491

 Score = 34.3 bits (75), Expect = 3.4
 Identities = 18/52 (34%), Positives = 30/52 (57%)
 Frame = -3

Query: 651 SYVSFRPLPTL*ERVKLFIYMYLNTKNKTLLYTSNYILIYKFLFARRSSVVP 496
           S V   PL TL   + +F+Y  ++ KNK+LL++    L+  FL A  +++ P
Sbjct: 201 SIVCTEPLYTLLMALLIFVYFKVSVKNKSLLHSCVLYLLLGFLCAAANAIRP 252


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 702,118,071
Number of Sequences: 1657284
Number of extensions: 13741222
Number of successful extensions: 32881
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 31521
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32837
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 63792713725
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)