BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0174 (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46239| Best HMM Match : Phage_integrase (HMM E-Value=0.24) 30 2.0 SB_56175| Best HMM Match : RRM_1 (HMM E-Value=0.27) 29 4.7 SB_40843| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_46239| Best HMM Match : Phage_integrase (HMM E-Value=0.24) Length = 364 Score = 29.9 bits (64), Expect = 2.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 393 WYCFGHH*CGSHSRCLHKDAR 331 W+C+G+ G SRC+H+ R Sbjct: 302 WFCWGYFSYGESSRCIHRGVR 322 >SB_56175| Best HMM Match : RRM_1 (HMM E-Value=0.27) Length = 601 Score = 28.7 bits (61), Expect = 4.7 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 1/74 (1%) Frame = +1 Query: 22 FLVTMMWKTVLITIFAAGVLADDFSQITAVVTSQCTKNNAEDKVPEVEAALRTFGNCLKG 201 FL + ++++ GV D +S I +V N A D + EVE A R Sbjct: 284 FLKVLKGAGAVLSVIGIGV--DLYSIINTLVECDKKSNQAADAIKEVEKAEREVSKSETE 341 Query: 202 LVDLNV-LKTEIEE 240 L D N LKT + E Sbjct: 342 LRDFNTELKTFMRE 355 >SB_40843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 184 GNCLKGLVDLNVLKTEIEE 240 GNCLKG+V++NV IE+ Sbjct: 277 GNCLKGIVNVNVSPNIIEQ 295 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,725,720 Number of Sequences: 59808 Number of extensions: 371465 Number of successful extensions: 865 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -