BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0173 (774 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 8.3 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 21 8.3 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 8.3 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 21 8.3 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = +3 Query: 189 LPQGTGRFKCSENRN*RSQAKRALDEVFKKYCDKS 293 +P G C + + K+ L +V++ YC S Sbjct: 640 VPSGNSTVDCDDVGTFGAILKKLLPKVYEDYCPTS 674 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 535 HSGEALFQIKKHVLRFS 485 HSGE ++ K +LRFS Sbjct: 100 HSGEKPYECKLCLLRFS 116 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 535 HSGEALFQIKKHVLRFS 485 HSGE ++ K +LRFS Sbjct: 356 HSGEKPYECKLCLLRFS 372 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 385 TVPINSSTLCATRTETG 435 T+ INS T+C T + G Sbjct: 146 TMEINSDTMCVTFSNLG 162 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,501 Number of Sequences: 336 Number of extensions: 3636 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -