BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0169 (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1247 - 32043776-32043880,32044296-32044505,32044595-320451... 29 5.2 >04_04_1247 - 32043776-32043880,32044296-32044505,32044595-32045101, 32045362-32045583,32046054-32046184,32046737-32047745, 32047830-32047904,32047995-32048066,32048153-32048328, 32048494-32048646,32048739-32049234 Length = 1051 Score = 28.7 bits (61), Expect = 5.2 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 211 FDSFRVKGKPLVTERGRQNESTHXSVTPTNINY 113 F S K +PL G ESTH +V P ++Y Sbjct: 103 FMSSSYKSRPLSLTGGNNVESTHPTVKPNTVHY 135 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,913,208 Number of Sequences: 37544 Number of extensions: 272584 Number of successful extensions: 432 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 432 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -