BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0169 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 24 1.3 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 7.1 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 9.3 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 24.2 bits (50), Expect = 1.3 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 376 CLFTCCLNVSCSTSIIYNRKIIAFIYNVASSTTVQ 480 C F ++V+CSTS I+N I+ +A + ++ Sbjct: 259 CDFYIAMDVTCSTSSIFNLVAISIDRYIAVTQPIK 293 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 120 MFVGVTEXWVDSFCRPRSVTNGFPLT 197 M++ V + V S RPRS G P T Sbjct: 199 MYISVFKAEVGSKLRPRSSFQGPPFT 224 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +2 Query: 101 ITMYVIYVCGRYGXVGRFILPTTLG 175 + V+Y+ R+ GRF L T G Sbjct: 578 VVALVLYLLDRFSPFGRFKLANTDG 602 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,437 Number of Sequences: 438 Number of extensions: 3692 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -