BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0166 (777 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosac... 27 4.0 SPAC343.19 ||SPAC824.01|phosphatidylinositol 4-kinase Lsb6 |Schi... 26 6.9 >SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 26.6 bits (56), Expect = 4.0 Identities = 19/50 (38%), Positives = 25/50 (50%) Frame = -1 Query: 741 VVPPGXAVTQXCPSVFDSVQSHVVVPV*KMRNKXSLFKFSGNQLPLXPKT 592 VV PG A + C S+ S H+V K RN+ SL + N L PK+ Sbjct: 82 VVTPGYA--RPCNSLAFSETEHLVAGFAKSRNESSLKLWDLNSLLSDPKS 129 >SPAC343.19 ||SPAC824.01|phosphatidylinositol 4-kinase Lsb6 |Schizosaccharomyces pombe|chr 1|||Manual Length = 624 Score = 25.8 bits (54), Expect = 6.9 Identities = 13/53 (24%), Positives = 24/53 (45%) Frame = +3 Query: 144 ADYDSAVERSKLIYTDNKGELITNVVNNLIRNNKMNCWSTPTSSGCKAPRTSS 302 A +S+ S L+ +N+G + + L+ +K W+ S +A R S Sbjct: 39 ASSNSSSSSSLLLPDENEGNEVFGSLKGLVTQSKFGQWANKLSKSLQARRRKS 91 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,782,093 Number of Sequences: 5004 Number of extensions: 50996 Number of successful extensions: 137 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 375345278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -