BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0166 (777 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U15954-1|AAA67442.1| 53|Apis mellifera abaecin precursor protein. 23 3.2 AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 23 4.2 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 5.5 >U15954-1|AAA67442.1| 53|Apis mellifera abaecin precursor protein. Length = 53 Score = 23.0 bits (47), Expect = 3.2 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -2 Query: 542 FGLSMPSSVCARVLYLEVDLVVLPQRNEFPADS*TGP 432 F ++ +++CA Y+ + V P R FP GP Sbjct: 6 FIFALLATICAAFAYVPLPNVPQPGRRPFPTFPGQGP 42 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 233 TKQQDELLEYAYQLWMQGSEDIVR 304 TK+Q+ L+ A + W++ + IVR Sbjct: 92 TKKQEMLVRSAIKYWVERHKHIVR 115 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.2 bits (45), Expect = 5.5 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 264 PTSSGCKAPRTSSGDCFPVEFTLILAE 344 PT C R ++G CF V + +L + Sbjct: 716 PTDIVCGIQRFAAGFCFTVVYAALLTK 742 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,393 Number of Sequences: 438 Number of extensions: 3595 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24396777 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -