BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0165 (740 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 36 3e-04 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 33 0.002 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 33 0.002 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 33 0.002 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 33 0.002 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 29 0.061 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 29 0.061 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 27 0.18 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 27 0.24 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 24 1.7 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 3.0 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 3.0 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 3.0 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 23 3.0 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 23 3.0 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 23 3.0 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 23 3.0 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 3.0 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 3.0 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 3.0 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 3.0 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 3.0 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 3.0 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 3.0 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 3.0 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 5.3 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 5.3 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 5.3 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 5.3 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 7.0 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 7.0 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 7.0 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 7.0 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 9.2 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 36.3 bits (80), Expect = 3e-04 Identities = 24/69 (34%), Positives = 39/69 (56%), Gaps = 8/69 (11%) Frame = -3 Query: 714 HLPGSXVRLH-GQAHERQRQTPSTCSK-------LDSFMYKLVNGKNTIVRSSMDMQGFI 559 ++PG+ VR+ G H+ Q + P + SK LD F+ L G+NTI+R+S G Sbjct: 529 NVPGAVVRVFLGPKHDHQGR-PISISKNQHLFVELDQFIQNLHAGENTIIRNSQQAPGQS 587 Query: 558 PEYLSTRRV 532 P++ ST ++ Sbjct: 588 PDWPSTSQI 596 Score = 29.9 bits (64), Expect = 0.026 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = -1 Query: 725 AVVXIFLGPKYDCMGRLMSVN 663 AVV +FLGPK+D GR +S++ Sbjct: 533 AVVRVFLGPKHDHQGRPISIS 553 Score = 23.8 bits (49), Expect = 1.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -2 Query: 292 PLGYPFDRPIDM 257 PLG+P DRP+ + Sbjct: 972 PLGFPLDRPLSL 983 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 33.5 bits (73), Expect = 0.002 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -2 Query: 460 GFPQRLMLPLGTIGGLEMQMYVIVSPV 380 GFP RL+LP G G+ Q+++ VSPV Sbjct: 599 GFPGRLLLPRGKKEGMPFQLFLYVSPV 625 Score = 27.1 bits (57), Expect = 0.18 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -1 Query: 737 KLVDAVVXIFLGPKYDCMGRLMSVND--KRLRHVRSW 633 K + A + IF+GPKYD +L+ + + K + +W Sbjct: 510 KPMKAAIRIFIGPKYDSHHKLIEIPEDLKYFYEIDNW 546 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 33.5 bits (73), Expect = 0.002 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = -2 Query: 460 GFPQRLMLPLGTIGGLEMQMYVIVSPVRTGMLLPTLDMTMMKDRCACRWSSCI-STMPLG 284 GFP+RL+LP G G+ + V+VSP ++ +D + W I +G Sbjct: 597 GFPERLLLPKGKKEGMPYNVLVVVSPFDDSNVV-QIDSPV--------WGRHIYDGRAMG 647 Query: 283 YPFDRPID 260 +P D+P+D Sbjct: 648 FPLDKPVD 655 Score = 26.6 bits (56), Expect = 0.24 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 737 KLVDAVVXIFLGPKYDCMG 681 K V +V IFLGPKYD G Sbjct: 508 KNVKGMVRIFLGPKYDEFG 526 Score = 25.4 bits (53), Expect = 0.56 Identities = 13/45 (28%), Positives = 27/45 (60%) Frame = -3 Query: 639 KLDSFMYKLVNGKNTIVRSSMDMQGFIPEYLSTRRVMESEMMPSE 505 ++D F+ L +G NTI R+S + +P+ + + V+ + ++ SE Sbjct: 540 QMDEFVVNLKSGSNTIERNSHESVFVVPDEVPS-DVLYNRLVVSE 583 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 33.5 bits (73), Expect = 0.002 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -2 Query: 460 GFPQRLMLPLGTIGGLEMQMYVIVSPV 380 GFP RL+LP G G+ Q+++ VSPV Sbjct: 599 GFPGRLLLPRGKKEGMPFQLFLYVSPV 625 Score = 27.1 bits (57), Expect = 0.18 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -1 Query: 737 KLVDAVVXIFLGPKYDCMGRLMSVND--KRLRHVRSW 633 K + A + IF+GPKYD +L+ + + K + +W Sbjct: 510 KPMKAAIRIFIGPKYDSHHKLIEIPEDLKYFYEIDNW 546 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 33.5 bits (73), Expect = 0.002 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = -2 Query: 460 GFPQRLMLPLGTIGGLEMQMYVIVSPVRTGMLLPTLDMTMMKDRCACRWSSCI-STMPLG 284 GFP+RL+LP G G+ + V+VSP ++ +D + W I +G Sbjct: 597 GFPERLLLPKGKKEGMPYNVLVVVSPFDDSNVV-QIDSPV--------WGRHIYDGRAMG 647 Query: 283 YPFDRPID 260 +P D+P+D Sbjct: 648 FPLDKPVD 655 Score = 26.6 bits (56), Expect = 0.24 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 737 KLVDAVVXIFLGPKYDCMG 681 K V +V IFLGPKYD G Sbjct: 508 KNVKGMVRIFLGPKYDEFG 526 Score = 25.4 bits (53), Expect = 0.56 Identities = 13/45 (28%), Positives = 27/45 (60%) Frame = -3 Query: 639 KLDSFMYKLVNGKNTIVRSSMDMQGFIPEYLSTRRVMESEMMPSE 505 ++D F+ L +G NTI R+S + +P+ + + V+ + ++ SE Sbjct: 540 QMDEFVVNLKSGSNTIERNSHESVFVVPDEVPS-DVLYNRLVVSE 583 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 28.7 bits (61), Expect = 0.061 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -2 Query: 526 KRNDAFGDGQTMVKDWWCKSRNGFPQRLMLPLGTIGGLEMQMYVIVS 386 K N A G + + + GFP+RL+LP G G+ +M+ +S Sbjct: 582 KLNKAIGGSEPFT---YSEKMLGFPERLILPRGKPEGMRYKMFFFLS 625 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 28.7 bits (61), Expect = 0.061 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -2 Query: 526 KRNDAFGDGQTMVKDWWCKSRNGFPQRLMLPLGTIGGLEMQMYVIVS 386 K N A G + + + GFP+RL+LP G G+ +M+ +S Sbjct: 582 KLNKAIGGSEPFT---YSEKMLGFPERLILPRGKPEGMRYKMFFFLS 625 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 27.1 bits (57), Expect = 0.18 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -3 Query: 195 HVEHQQDRGHLGDGHDEGR--SHLPGLGHAGQEDLQRRH 85 + +HQQD G DG R S PG+GH G H Sbjct: 93 YYQHQQDHGSGMDGMGGYRSASPSPGMGHMGHTPTPNGH 131 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 26.6 bits (56), Expect = 0.24 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 737 KLVDAVVXIFLGPKYDCMG 681 K V +V IFLGPKYD G Sbjct: 134 KNVKGMVRIFLGPKYDEFG 152 Score = 24.6 bits (51), Expect = 0.99 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -3 Query: 639 KLDSFMYKLVNGKNTIVRSSMDMQGFIP 556 ++D F+ L +G NTI R+S + +P Sbjct: 166 QMDEFVVNLKSGSNTIERNSHESXFVVP 193 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 23.8 bits (49), Expect = 1.7 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = -3 Query: 663 RQTPSTCSKLDSFMYKLVNGKNTIVRSSMDMQGFIPEYLSTRRVMESEMMPSEMARQWSR 484 R+ + +LD F L GKNTI + S IP + R + E+ + + ++ Sbjct: 519 REQKNLMIELDKFPITLQPGKNTIEQKSTKSSVTIPFERTFRNLDENRPIGGDSLERFDF 578 Query: 483 TG 478 G Sbjct: 579 CG 580 Score = 23.4 bits (48), Expect = 2.3 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -1 Query: 479 VVQVSQRIPSETYAAPRYDWRFGDADVRHRVA 384 VV R+P E PR D+ D DV HRVA Sbjct: 170 VVPEGARVPIEI---PR-DYTASDLDVEHRVA 197 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKTV S + DD++ Sbjct: 94 SNTSKTVILSNKLESSDDIS 113 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKTV S + DD++ Sbjct: 94 SNTSKTVILSNKLESSDDIS 113 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -1 Query: 686 MGRLMSVNDKRLRHVRSWTALCTNWSTERTP 594 +GR S ++LR++ WT + +R P Sbjct: 126 VGRKKSSGWRKLRNIVHWTPFFQTYKKQRYP 156 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 105 LDQHVRVQVGEIVLHHDH 158 L +H V +GEI HH++ Sbjct: 512 LQEHDSVMLGEISPHHEY 529 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 7.0 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = -1 Query: 626 LCTNWSTERTPSSVAPWI 573 L NW T PS + W+ Sbjct: 326 LVDNWMTYMPPSGIPNWV 343 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 191 SNTSKTVDTSEMVMMKDDLT 132 SNTSKT+ S + DD++ Sbjct: 94 SNTSKTIILSNKLESSDDIS 113 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 7.0 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = -1 Query: 626 LCTNWSTERTPSSVAPWI 573 L NW T PS + W+ Sbjct: 326 LIDNWMTYMPPSGIPNWV 343 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.8 bits (44), Expect = 7.0 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +1 Query: 262 QSVCQMDIREAWWRYMSSS 318 Q VCQ ++ + WW S+ Sbjct: 356 QPVCQNEMNKWWWNMKISN 374 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/31 (25%), Positives = 14/31 (45%) Frame = +1 Query: 298 WRYMSSSDKHNGPSSWSCPMWARAYRCGPAT 390 W+Y ++++ H S+ W R G T Sbjct: 124 WKYYTTNESHACLSTGGSCYWPRGKNLGGTT 154 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,413 Number of Sequences: 438 Number of extensions: 4254 Number of successful extensions: 54 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -