BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0163 (785 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_1026 + 22400551-22401161,22401437-22401632,22401837-224018... 31 1.4 09_04_0417 + 17404433-17405392 28 7.3 >10_08_1026 + 22400551-22401161,22401437-22401632,22401837-22401889, 22402369-22402819 Length = 436 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/51 (35%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = +2 Query: 584 DTPKVPGNNGLRDMVTLLRWGEXGTPEPWEVN----PXQRDLWRGXSAWXP 724 D P GN+ R ++ WGE G PEP + P D W G A P Sbjct: 83 DDPSASGNS--RPVLVTDEWGEPGVPEPQSTSAADPPTNDDEWGGDPAPPP 131 >09_04_0417 + 17404433-17405392 Length = 319 Score = 28.3 bits (60), Expect = 7.3 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 4/98 (4%) Frame = +2 Query: 278 LDATEEGPVCYQTDVLYGSLMKPHGMDEAC-IYANIHVPLNALPAAGXTPTKPGLPIXVF 454 L TE P + D G K +D+A + A +++P LPA+G + LPI V+ Sbjct: 26 LFGTETTPAGF--DGATGVTSKDVVIDDATGVSARLYIP--DLPASGPGHHRKKLPIVVY 81 Query: 455 IHXXXXXXXXXXXDLYG---PSILSTRNVVVITFNYRL 559 H Y S++S + ++ NYRL Sbjct: 82 FHGGGMVLDSAASPTYHRYLNSLVSKAGALAVSVNYRL 119 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,895,870 Number of Sequences: 37544 Number of extensions: 438588 Number of successful extensions: 1007 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 980 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1007 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2115411120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -