BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0162 (746 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16A3.03c |lyn1||sequence orphan|Schizosaccharomyces pombe|ch... 26 5.0 SPAC2F3.18c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 26 6.6 >SPBC16A3.03c |lyn1||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 658 Score = 26.2 bits (55), Expect = 5.0 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = -3 Query: 579 FTEXLILISIWTHHHHLPSNTGIIVSLSTKASSSVKEIALNRRFWYAVHFYF 424 + + L LIS+W H PS + L S S++ + +NR++ A F++ Sbjct: 358 YKDILSLISVWQHSVWRPS----LAYLQVVYSFSMRALLVNRQYSSAFAFFW 405 >SPAC2F3.18c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 110 Score = 25.8 bits (54), Expect = 6.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 14 VGIYPIC*IGFDFANSQNTYKY 79 V IY +C + F NS+N +KY Sbjct: 71 VVIYAVCLMNIFFRNSENCFKY 92 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,804,455 Number of Sequences: 5004 Number of extensions: 54190 Number of successful extensions: 120 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -