BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0162 (746 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0043 - 14390398-14391531,14391850-14393691,14393800-143968... 29 3.9 03_01_0259 - 1996427-1998772 28 6.9 >10_08_0043 - 14390398-14391531,14391850-14393691,14393800-14396825, 14397510-14397609 Length = 2033 Score = 29.1 bits (62), Expect = 3.9 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = +3 Query: 171 NHINVSVDTEKLQNCVCNRK-INYLSFIKLVKNSIANNIVIRIISKIEDSLHY 326 NH++ S++ L+NC+ + K N F + K + AN+ +IS+++D Y Sbjct: 1130 NHMSASINVVILENCLADLKDKNVDLFNECQKFAEANHAAEMLISQMKDEARY 1182 >03_01_0259 - 1996427-1998772 Length = 781 Score = 28.3 bits (60), Expect = 6.9 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -1 Query: 377 HC--IMSYVGXRGNKERPSVM*AIFYFTNNPNDNVVGYRIFDKLNKRKVI 234 HC I SY+ G E +M A+ + D V IFDK+ + VI Sbjct: 429 HCRQIHSYIIGLGYAENTLIMNAVLHMYARSGDVVASREIFDKMVSKDVI 478 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,809,177 Number of Sequences: 37544 Number of extensions: 309559 Number of successful extensions: 561 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 559 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -