BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0156 (762 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15782| Best HMM Match : DUF845 (HMM E-Value=5.8) 29 3.1 SB_2235| Best HMM Match : Arf (HMM E-Value=3.1e-13) 29 4.1 SB_18563| Best HMM Match : K_tetra (HMM E-Value=4.34403e-44) 28 7.2 >SB_15782| Best HMM Match : DUF845 (HMM E-Value=5.8) Length = 283 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 125 GFEENLMRNWVCLVEHESSRDTSKTN 202 GFEE + R W+ + E S D +KTN Sbjct: 33 GFEEEVKRQWIGCDKLEGSNDITKTN 58 >SB_2235| Best HMM Match : Arf (HMM E-Value=3.1e-13) Length = 334 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 118 ETWLRRKSHEELGMSGRAREQP*HVQDEHEP 210 E WL RK H E +S RE+ V+++H+P Sbjct: 223 EAWLERKEHREDSLSEHEREE---VKNKHKP 250 >SB_18563| Best HMM Match : K_tetra (HMM E-Value=4.34403e-44) Length = 191 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 217 LEGLRIVPDQRPVWCSKGASPGKDCNVKCSDLLTD 321 L LR+VPD R W + AS D + + +++ D Sbjct: 43 LSTLRVVPDSRLAWIGENASKQADYDPETNEIFFD 77 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,427,658 Number of Sequences: 59808 Number of extensions: 387937 Number of successful extensions: 762 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -