BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0156 (762 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97593-5|AAB52880.1| 1175|Caenorhabditis elegans Prion-like-(q/n... 29 2.7 AL132858-1|CAB60474.1| 325|Caenorhabditis elegans Hypothetical ... 28 6.3 >U97593-5|AAB52880.1| 1175|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 22, isoform a protein. Length = 1175 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = +1 Query: 238 PDQRPVWCSKGASPGKDCNVKCSDLLTDDITKAAKCAKKIY----KRHRFDAWYG 390 P+QR VW + + K+ N++ LLTD+ +A K + Y + +AW G Sbjct: 459 PEQRDVWNIQQSEVDKEVNIR--TLLTDEALRAPKREQSPYWAGHSEQKHEAWRG 511 >AL132858-1|CAB60474.1| 325|Caenorhabditis elegans Hypothetical protein Y113G7A.1 protein. Length = 325 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +2 Query: 2 GNSKDTIEMQKLIIFALVV 58 G SK TI+MQ L+IFAL++ Sbjct: 222 GMSKKTIQMQHLLIFALIL 240 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,152,165 Number of Sequences: 27780 Number of extensions: 285964 Number of successful extensions: 707 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 706 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1819579054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -