BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0154 (690 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0817 - 20792817-20793360,20794061-20794156,20795193-20795296 59 4e-09 05_01_0148 - 985745-986180,986290-986385,986498-986694,986824-98... 41 0.001 03_02_0609 - 9823120-9823573,9823903-9824102,9824240-9824335,982... 41 0.001 05_01_0084 + 562119-562411,562854-562902,563151-563162,563194-56... 40 0.001 11_03_0226 - 11908455-11908562,11915971-11916240,11916463-119169... 40 0.002 04_04_0762 - 27844427-27844542,27844876-27844912,27845436-278458... 39 0.004 02_03_0076 - 14861337-14861974,14862008-14862119,14862150-14863580 39 0.004 11_04_0430 + 17653553-17654285,17654305-17654627,17654795-176549... 38 0.006 03_06_0481 - 34222012-34222287,34222371-34222439 38 0.008 05_01_0455 - 3614011-3614503,3615007-3615072,3615154-3615347,361... 38 0.010 11_06_0152 + 20669949-20670326,20670887-20670997,20671079-206712... 37 0.013 04_01_0453 + 5869627-5870232,5870383-5870897,5870964-5871600 37 0.013 05_03_0113 + 8526595-8527440,8527662-8528357 37 0.017 06_03_0046 - 15852653-15854560 36 0.023 02_01_0158 - 1103461-1104186 36 0.040 10_05_0023 + 8171023-8171782,8172658-8172950 34 0.093 05_05_0253 - 23632907-23633646,23633758-23635050,23636471-23636663 34 0.093 07_01_1134 + 10614565-10615821 33 0.16 08_01_0202 - 1638978-1639571 33 0.21 12_02_0814 - 23410278-23411854,23411933-23412166,23412688-234127... 32 0.37 11_05_0050 + 18665251-18665613,18667280-18667744,18668548-186690... 32 0.37 04_04_0752 - 27791126-27791167,27791792-27791863,27792771-277928... 32 0.37 01_01_0419 - 3146851-3147339,3148428-3148663,3148847-3149793,315... 32 0.49 12_02_0792 - 23191120-23191313,23191419-23191775,23192027-231921... 31 0.65 12_02_0556 + 20415683-20416841,20417563-20417726,20417837-204179... 31 0.65 11_06_0690 + 26303733-26306540 31 0.65 04_01_0590 + 7793958-7794148,7794826-7794967,7799292-7800548 31 0.65 05_03_0201 - 9762563-9762843,9763037-9763919,9763988-9764036,980... 31 0.86 04_04_1257 - 32155935-32156526,32156655-32157067 31 0.86 03_06_0531 + 34552206-34552598,34552665-34552735,34553363-345533... 31 0.86 05_07_0219 - 28474661-28475146,28475979-28476644 31 1.1 09_06_0087 + 20771329-20771450,20771462-20771771,20771893-207726... 30 1.5 06_03_0368 - 19966741-19967204,19967279-19967450 30 1.5 02_01_0137 + 988442-988641,989088-989281,989369-989488,989594-98... 30 1.5 12_01_0686 - 5855216-5858263 30 2.0 09_03_0144 - 12728697-12729238,12729312-12729432 30 2.0 01_03_0282 - 14580875-14580891,14582126-14585855 30 2.0 10_02_0188 - 6473353-6473432,6473619-6474816 29 2.6 09_02_0546 - 10454404-10455687 29 2.6 05_01_0553 + 4849535-4849553,4850727-4851913 29 3.5 02_02_0178 + 7490447-7490659,7490996-7491112,7491337-7491517,749... 29 3.5 08_02_0699 + 20155509-20156189 29 4.6 05_04_0281 + 19779156-19779805,19781303-19781475,19781909-197821... 29 4.6 01_06_1507 - 37838645-37839311,37839393-37839499,37839588-378396... 29 4.6 10_06_0142 - 11175732-11176545,11176924-11177450,11177544-111777... 28 6.1 10_04_0004 + 7389321-7390013 28 6.1 09_06_0188 - 21441377-21442201 28 6.1 07_03_0964 - 22989470-22989618,22989729-22990476 28 6.1 06_03_0767 - 24436161-24436460 28 6.1 04_03_0151 + 11905926-11906618 28 6.1 01_04_0136 + 16506747-16506982,16507128-16507728,16510443-165108... 28 6.1 12_02_0541 + 20162313-20162374,20162670-20163419,20164627-201648... 28 8.0 06_03_0062 + 16116893-16117029,16117472-16117760 28 8.0 05_07_0246 + 28634530-28634735,28634841-28634901,28634996-286350... 28 8.0 05_03_0382 + 13342764-13342958,13343178-13343278,13343373-133434... 28 8.0 05_01_0112 - 757514-758444,758525-758571,759074-759236,759861-76... 28 8.0 >10_08_0817 - 20792817-20793360,20794061-20794156,20795193-20795296 Length = 247 Score = 58.8 bits (136), Expect = 4e-09 Identities = 25/56 (44%), Positives = 32/56 (57%) Frame = -1 Query: 468 ELLRCYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDCVNEQFCPLCNKKGHTA 301 E+ C C+K GH A C E +AC C ++GH+A +C NE C LCN GH A Sbjct: 120 EMRLCSNCYKPGHLAAECTNE---KACNNCRKSGHLARNCPNEPVCNLCNVSGHLA 172 Score = 51.6 bits (118), Expect = 6e-07 Identities = 23/52 (44%), Positives = 25/52 (48%) Frame = -1 Query: 456 CYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDCVNEQFCPLCNKKGHTA 301 C+ C GH A C +D C C E GHMA C NE C C K GH A Sbjct: 60 CHACGLPGHIAAECSSKD---LCWNCKEPGHMANSCPNEGICRNCGKSGHIA 108 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 7/59 (11%) Frame = -1 Query: 456 CYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDCV-------NEQFCPLCNKKGHTA 301 C+ C + GH A++C E CR C ++GH+A +C + C C K GH A Sbjct: 79 CWNCKEPGHMANSCPNEG---ICRNCGKSGHIARECSAPPMLPGEMRLCSNCYKPGHLA 134 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = -1 Query: 456 CYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDCVNEQFCPLCNKKGHTAGT 295 C C + GH A +C C C GH+A +C ++ C C + GH A + Sbjct: 41 CNNCKRPGHFARDCPNV---ALCHACGLPGHIAAECSSKDLCWNCKEPGHMANS 91 Score = 35.1 bits (77), Expect = 0.053 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 390 CRRCSEAGHMAGDCVNEQF--CPLCNKKGHTA 301 CR C++ GHM+ DC+ F C C +GH A Sbjct: 199 CRACNQVGHMSRDCMAGAFMICHNCGGRGHMA 230 >05_01_0148 - 985745-986180,986290-986385,986498-986694,986824-986919, 987020-987059,987751-987857 Length = 323 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -1 Query: 459 RCYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDCVN 343 RC+ C GH A +C D C RC E GH+ +C N Sbjct: 103 RCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQN 141 >03_02_0609 - 9823120-9823573,9823903-9824102,9824240-9824335, 9824454-9824567,9824711-9824774,9825206-9825312 Length = 344 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -1 Query: 459 RCYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDCVN 343 RC+ C GH A +C D C RC E GH+ +C N Sbjct: 150 RCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQN 188 >05_01_0084 + 562119-562411,562854-562902,563151-563162,563194-563327, 563716-566278 Length = 1016 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 5/57 (8%) Frame = -1 Query: 456 CYRCWKYGHKADNCDGEDR-SRACRRCSEAGHMAGDC----VNEQFCPLCNKKGHTA 301 CY+C + GH A +C G+ C +C + GH + DC C C + GH A Sbjct: 926 CYKCKQPGHYARDCPGQSTGGLECFKCKQPGHFSRDCPVQSTGGSECFKCKQPGHFA 982 Score = 34.7 bits (76), Expect = 0.070 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -1 Query: 462 LRCYRCWKYGHKADNCDGEDRSRA-CRRCSEAGHMAGDC 349 L C++C + GH + +C + + C +C + GH A DC Sbjct: 947 LECFKCKQPGHFSRDCPVQSTGGSECFKCKQPGHFARDC 985 >11_03_0226 - 11908455-11908562,11915971-11916240,11916463-11916946, 11917148-11918060,11918628-11919300 Length = 815 Score = 39.5 bits (88), Expect = 0.002 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -1 Query: 396 RACRRCSEAGHMAGDCVNEQFCPLCNKKGHTA 301 + C +C E GH+A DCV E +C +C+ H + Sbjct: 381 KVCSKCFEKGHVADDCVVEVYCDICDSFDHVS 412 Score = 29.1 bits (62), Expect = 3.5 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = -1 Query: 456 CYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDC-VNEQFCPLCNKKGHTAGTSGCSL 280 C +C++ GH AD+C E C C H++ C V + P+ G G C++ Sbjct: 383 CSKCFEKGHVADDCVVE---VYCDICDSFDHVSHKCPVLKLPKPVVQAVGMVEGLGFCNI 439 Query: 279 FREALETASE 250 + L+ + + Sbjct: 440 PHQPLQRSKK 449 >04_04_0762 - 27844427-27844542,27844876-27844912,27845436-27845867, 27846036-27846740 Length = 429 Score = 38.7 bits (86), Expect = 0.004 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -1 Query: 429 KADNCDGEDRSRACRRCSEAGHMAGDCVNEQFCPLCNKKGH 307 K D+ G R + C RC++ GH DC + +C +C+ H Sbjct: 64 KGDDQKGGARVKVCSRCTQKGHGVADCKVDVYCDICDCSEH 104 >02_03_0076 - 14861337-14861974,14862008-14862119,14862150-14863580 Length = 726 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = -1 Query: 456 CYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDC 349 C RC GH A NC G R C C EAGHM+ C Sbjct: 230 CVRCLDKGHIASNCSGPVR---CHSCLEAGHMSCFC 262 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -1 Query: 393 ACRRCSEAGHMAGDCVNEQFCPLCNKKGH 307 +C RC + GH+A +C C C + GH Sbjct: 229 SCVRCLDKGHIASNCSGPVRCHSCLEAGH 257 >11_04_0430 + 17653553-17654285,17654305-17654627,17654795-17654921, 17655123-17655338,17655463-17655494 Length = 476 Score = 38.3 bits (85), Expect = 0.006 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -1 Query: 429 KADNCDGEDRSRACRRCSEAGHMAGDCVNEQFCPLCNKKGH 307 K D+ G R + C RC++ GH DC + +C +C+ H Sbjct: 187 KGDDQKGGARVKVCSRCTQKGHGVADCKVDVYCDICDCSVH 227 >03_06_0481 - 34222012-34222287,34222371-34222439 Length = 114 Score = 37.9 bits (84), Expect = 0.008 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 10/60 (16%) Frame = -1 Query: 456 CYRCWKYGHKADNCD----------GEDRSRACRRCSEAGHMAGDCVNEQFCPLCNKKGH 307 C C GH A NC G R CR C + GH++ +C+ C C +GH Sbjct: 37 CNLCNVSGHLARNCQKTTISSEIQGGPFRDITCRLCGKPGHISRNCMTTMICGTCGGRGH 96 Score = 35.5 bits (78), Expect = 0.040 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 369 GHMAGDCVNEQFCPLCNKKGHTA 301 GH+A +C NE C LCN GH A Sbjct: 25 GHIARECTNEPVCNLCNVSGHLA 47 >05_01_0455 - 3614011-3614503,3615007-3615072,3615154-3615347, 3615562-3615657,3615790-3615829,3616729-3616856 Length = 338 Score = 37.5 bits (83), Expect = 0.010 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -1 Query: 456 CYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDCVN 343 C+ C GH NC D + C C E GH+ +C N Sbjct: 110 CFNCGMEGHWHRNCTAGDWTNRCYGCGERGHILRECKN 147 >11_06_0152 + 20669949-20670326,20670887-20670997,20671079-20671280, 20671393-20671675,20672145-20672234,20672366-20672473, 20672595-20672975,20673250-20673324,20673685-20673797, 20676233-20676742,20676807-20677300 Length = 914 Score = 37.1 bits (82), Expect = 0.013 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -1 Query: 456 CYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDC 349 C+ C + GH A NC E R R C C GH + C Sbjct: 179 CFNCGEEGHVAVNCPMEKRKRPCFVCGLFGHNSKQC 214 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -1 Query: 411 GEDRSRACRRCSEAGHMAGDCVNEQF---CPLCNKKGHTA 301 GE C C E GH+A +C E+ C +C GH + Sbjct: 172 GETLLETCFNCGEEGHVAVNCPMEKRKRPCFVCGLFGHNS 211 >04_01_0453 + 5869627-5870232,5870383-5870897,5870964-5871600 Length = 585 Score = 37.1 bits (82), Expect = 0.013 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = -1 Query: 390 CRRCSEAGHMAGDCVNEQFCPLCNKKGHTAGTSGCSLFREALETASE 250 C RC GH+ DC ++ +C +C + H A + C +FR ++ ++ Sbjct: 274 CFRCLTKGHIMQDCSSKFYCEICESEDHIA--TRCPIFRSNVKPTAQ 318 >05_03_0113 + 8526595-8527440,8527662-8528357 Length = 513 Score = 36.7 bits (81), Expect = 0.017 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 390 CRRCSEAGHMAGDCVNEQFCPLCNKKGH 307 C +C++ GH+ DC E C +CN H Sbjct: 207 CSKCAQKGHVVADCTIEVCCDICNSDSH 234 >06_03_0046 - 15852653-15854560 Length = 635 Score = 36.3 bits (80), Expect = 0.023 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 393 ACRRCSEAGHMAGDCVNEQFCPLCNKKGHTA 301 +C RC + GH+A DC +C C + GH A Sbjct: 228 SCTRCLDKGHIASDCSEPVWCHSCLEAGHMA 258 Score = 34.3 bits (75), Expect = 0.093 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = -1 Query: 465 LLRCYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDC 349 +L C RC GH A +C C C EAGHMA C Sbjct: 226 MLSCTRCLDKGHIASDCS---EPVWCHSCLEAGHMARFC 261 >02_01_0158 - 1103461-1104186 Length = 241 Score = 35.5 bits (78), Expect = 0.040 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 10/48 (20%) Frame = -1 Query: 456 CYRCWKYGHKADNC----------DGEDRSRACRRCSEAGHMAGDCVN 343 C++C + GH A +C G AC C E GH+A DC N Sbjct: 161 CFKCGEMGHMARDCFNSGGGGGGGGGGGGGGACYNCGETGHLARDCYN 208 Score = 34.7 bits (76), Expect = 0.070 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 11/47 (23%) Frame = -1 Query: 456 CYRCWKYGHKADNCD-----------GEDRSRACRRCSEAGHMAGDC 349 CY C + GH A +C G R+C C EAGH+A DC Sbjct: 193 CYNCGETGHLARDCYNGGGGGGGGRFGGGGDRSCYNCGEAGHIARDC 239 Score = 32.7 bits (71), Expect = 0.28 Identities = 17/51 (33%), Positives = 22/51 (43%), Gaps = 13/51 (25%) Frame = -1 Query: 456 CYRCWKYGHKADNC-------------DGEDRSRACRRCSEAGHMAGDCVN 343 C++C + GH A +C G C +C E GHMA DC N Sbjct: 126 CFKCGESGHMARDCFNGGGVGVGGGGGGGGGAGGGCFKCGEMGHMARDCFN 176 >10_05_0023 + 8171023-8171782,8172658-8172950 Length = 350 Score = 34.3 bits (75), Expect = 0.093 Identities = 21/60 (35%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = -1 Query: 477 ERIELLRCYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDCVNEQF-CPLCNKKGHTA 301 E +E C RC + GH A C C C E H G+C + C LC GH A Sbjct: 206 EEMESKACTRCGEIGHVASMC-----LTLCTHCEE-DHPPGECPTRKVTCFLCEGMGHFA 259 Score = 31.1 bits (67), Expect = 0.86 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -1 Query: 408 EDRSRACRRCSEAGHMAGDCVNEQFCPLCNKKGHTAG 298 E S+AC RC E GH+A C+ C C ++ H G Sbjct: 207 EMESKACTRCGEIGHVASMCLT--LCTHC-EEDHPPG 240 >05_05_0253 - 23632907-23633646,23633758-23635050,23636471-23636663 Length = 741 Score = 34.3 bits (75), Expect = 0.093 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = -1 Query: 498 LNICHIYERIELLRCYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDCVNEQFCPL 325 LN+ ++ I +C+RC+ H+A C R CRR +GH++ C N+ P+ Sbjct: 248 LNLREKFKEILHGKCFRCFASDHQAAACRDPIRCYTCRR---SGHISFRCPNKSKQPI 302 >07_01_1134 + 10614565-10615821 Length = 418 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = -1 Query: 408 EDRSRACRRCSEAGHMAGDCVNEQFCPLCNKKGHTAG 298 E S+AC RC E GH+A C CP C ++ H G Sbjct: 248 EMESKACPRCGEIGHVASLCFT--LCPYC-EEDHPPG 281 Score = 27.9 bits (59), Expect = 8.0 Identities = 19/58 (32%), Positives = 22/58 (37%), Gaps = 1/58 (1%) Frame = -1 Query: 477 ERIELLRCYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDCVNEQF-CPLCNKKGH 307 E +E C RC + GH A C C C E H G C + C LC H Sbjct: 247 EEMESKACPRCGEIGHVASLC-----FTLCPYCEE-DHPPGKCPTRKVTCFLCEGTNH 298 >08_01_0202 - 1638978-1639571 Length = 197 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 411 GEDRSRACRRCSEAGHMAGDC 349 G SRAC +C E GHMA DC Sbjct: 130 GGGGSRACYKCGEEGHMARDC 150 >12_02_0814 - 23410278-23411854,23411933-23412166,23412688-23412725, 23412872-23412948 Length = 641 Score = 32.3 bits (70), Expect = 0.37 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -1 Query: 456 CYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDC 349 C+ C GH+ C G R C C +GH+A +C Sbjct: 132 CFNCLGLGHQKSACPGSTR---CYNCWYSGHIARNC 164 Score = 31.9 bits (69), Expect = 0.49 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 459 RCYRCWKYGHKADNCDGEDRSRA 391 RCY CW GH A NC +RA Sbjct: 150 RCYNCWYSGHIARNCPTSRAARA 172 >11_05_0050 + 18665251-18665613,18667280-18667744,18668548-18669037, 18669115-18669143 Length = 448 Score = 32.3 bits (70), Expect = 0.37 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 6/47 (12%) Frame = -1 Query: 402 RSRACRRCSEAGHMAGDCVNEQFCPL------CNKKGHTAGTSGCSL 280 RS C RC E GH + +C PL C K GH G S L Sbjct: 400 RSNPCYRCGEDGHWSRNCPKPASSPLNSPCYNCGKLGHWRGPSEARL 446 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = -1 Query: 456 CYRCWKYGHKADNCD---GEDRSRACRRCSEAGHMAG 355 CYRC + GH + NC + C C + GH G Sbjct: 404 CYRCGEDGHWSRNCPKPASSPLNSPCYNCGKLGHWRG 440 >04_04_0752 - 27791126-27791167,27791792-27791863,27792771-27792855, 27792971-27793236,27794117-27794301,27794925-27795018, 27795193-27795284,27795401-27795539,27796101-27796385 Length = 419 Score = 32.3 bits (70), Expect = 0.37 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 11/61 (18%) Frame = -1 Query: 456 CYRCWKYGHKADNC---DGEDRSRACRRCSEAGHMAGDCV------NEQF--CPLCNKKG 310 C C + GH NC + E+ + C C E+GH C +F C +C ++G Sbjct: 97 CLLCRQRGHSLKNCPDKNDENLKKFCYNCGESGHSLSKCPKPIENGGTKFASCFVCKQQG 156 Query: 309 H 307 H Sbjct: 157 H 157 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/43 (30%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = -1 Query: 456 CYRCWKYGHKADNCDGED-----RSRACRRCSEAGHMAGDCVN 343 C+ C + GH + NC + C+ C E H+A C N Sbjct: 149 CFVCKQQGHLSKNCPENKHGIYPKGGCCKICGEVTHLAKHCPN 191 >01_01_0419 - 3146851-3147339,3148428-3148663,3148847-3149793, 3150258-3150356,3151128-3151501 Length = 714 Score = 31.9 bits (69), Expect = 0.49 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 462 LRCYRCWKYGHKADNCD 412 + C+RC K+GH AD CD Sbjct: 674 IECHRCGKFGHFADECD 690 >12_02_0792 - 23191120-23191313,23191419-23191775,23192027-23192108, 23192186-23193097,23193190-23193346,23193540-23193694, 23194667-23194819,23195334-23195627,23195711-23195896, 23196062-23196662,23196868-23196992,23197101-23197197, 23197299-23197411,23198129-23198233 Length = 1176 Score = 31.5 bits (68), Expect = 0.65 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -1 Query: 408 EDRSRACRRCSEAGHMAGDC 349 +DRS+ C +C ++GH++ DC Sbjct: 996 DDRSKICYKCKKSGHLSRDC 1015 >12_02_0556 + 20415683-20416841,20417563-20417726,20417837-20417926, 20427889-20429145 Length = 889 Score = 31.5 bits (68), Expect = 0.65 Identities = 19/58 (32%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = -1 Query: 477 ERIELLRCYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDCVNEQF-CPLCNKKGH 307 E +E C RC + GH A C C C E H G+C+ + C LC H Sbjct: 718 EEMESKACPRCGEIGHIASMC-----LTLCTHCEE-DHPPGECLTRKVTCFLCEGTNH 769 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -1 Query: 408 EDRSRACRRCSEAGHMAGDCVNEQFCPLCNKKGHTAG 298 E S+AC RC E GH+A C+ C C ++ H G Sbjct: 719 EMESKACPRCGEIGHIASMCLT--LCTHC-EEDHPPG 752 >11_06_0690 + 26303733-26306540 Length = 935 Score = 31.5 bits (68), Expect = 0.65 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -1 Query: 459 RCYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDC 349 RC+ C GH +C G R C RC +G++ DC Sbjct: 93 RCFCCLGLGHLKADCKGAPR---CYRCWFSGYLERDC 126 >04_01_0590 + 7793958-7794148,7794826-7794967,7799292-7800548 Length = 529 Score = 31.5 bits (68), Expect = 0.65 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = -1 Query: 408 EDRSRACRRCSEAGHMAGDCVNEQFCPLCNKKGHTAG 298 E S+AC RC E GH+A C CP C ++ H G Sbjct: 359 EMESKACPRCGEIGHVAIMCFT--LCPHC-EEDHPPG 392 Score = 29.1 bits (62), Expect = 3.5 Identities = 19/58 (32%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = -1 Query: 477 ERIELLRCYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDCVNEQF-CPLCNKKGH 307 E +E C RC + GH A C C C E H G+C + C LC H Sbjct: 358 EEMESKACPRCGEIGHVAIMC-----FTLCPHCEE-DHPPGECPTRKVTCFLCEGTNH 409 >05_03_0201 - 9762563-9762843,9763037-9763919,9763988-9764036, 9806710-9807680 Length = 727 Score = 31.1 bits (67), Expect = 0.86 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -1 Query: 408 EDRSRACRRCSEAGHMAGDCVNEQFCPLCNKKGHTAG 298 E S+AC RC E GH+A C+ C C ++ H G Sbjct: 588 EMESKACTRCGEIGHVASMCLT--LCTHC-EEDHPPG 621 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 414 DGEDRSRACRRCSEAGHMAGDC 349 + E +AC RC E GH+A C Sbjct: 185 EDEMERKACSRCGEIGHVASSC 206 Score = 29.1 bits (62), Expect = 3.5 Identities = 18/53 (33%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 477 ERIELLRCYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDCVNEQF-CPLC 322 E +E C RC + GH A C C C E H G+C + C LC Sbjct: 587 EEMESKACTRCGEIGHVASMC-----LTLCTHCEE-DHPPGECPTRKVTCFLC 633 >04_04_1257 - 32155935-32156526,32156655-32157067 Length = 334 Score = 31.1 bits (67), Expect = 0.86 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -1 Query: 408 EDRSRACRRCSEAGHMAGDCVNEQFCPLCNKKGHTAG 298 E S+AC RC E GH+A C+ C C ++ H G Sbjct: 164 EMESKACIRCGEIGHIASMCLT--LCAYC-EEDHPPG 197 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/58 (32%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = -1 Query: 477 ERIELLRCYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDCVNEQF-CPLCNKKGH 307 E +E C RC + GH A C C C E H G+C + C LC H Sbjct: 163 EEMESKACIRCGEIGHIASMC-----LTLCAYCEE-DHPPGECPTRKVTCFLCEGTNH 214 >03_06_0531 + 34552206-34552598,34552665-34552735,34553363-34553369, 34553603-34553736,34553834-34554245,34554655-34554753, 34555059-34555283,34555652-34556029,34556412-34556555, 34556832-34556927,34557228-34557547,34557965-34558040 Length = 784 Score = 31.1 bits (67), Expect = 0.86 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = -1 Query: 438 YGHKADNCDGEDRSR----ACRRCSEAGHMAGDCVNE 340 +G ++ + D SR AC C E+GH A DC N+ Sbjct: 748 FGGRSSSFGSRDSSRSFSGACFNCGESGHRASDCPNK 784 >05_07_0219 - 28474661-28475146,28475979-28476644 Length = 383 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -1 Query: 462 LRCYRCWKYGHKADNCDGEDRSRA 391 + C RC K+GH AD CD E R A Sbjct: 343 IECRRCGKFGHFADECD-EPRKMA 365 >09_06_0087 + 20771329-20771450,20771462-20771771,20771893-20772672, 20772854-20774002 Length = 786 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -1 Query: 459 RCYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDC 349 RC+RC GH +C + C RC GH+ +C Sbjct: 70 RCFRCLGLGHLKASC---SQPPTCYRCWYPGHIERNC 103 >06_03_0368 - 19966741-19967204,19967279-19967450 Length = 211 Score = 30.3 bits (65), Expect = 1.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -1 Query: 462 LRCYRCWKYGHKADNCD 412 + C RC K+GH AD CD Sbjct: 171 IECCRCGKFGHFADECD 187 >02_01_0137 + 988442-988641,989088-989281,989369-989488,989594-989673, 990244-990510,990840-992458,992571-993327,993560-995506 Length = 1727 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 1/73 (1%) Frame = +1 Query: 394 PTPILAVAVIRFVAIFPAPVTSQQFYSFIYVAYIEPYSSLPPASNLPGILFIQDHRC-RL 570 P P+++ I+ V+ FP V Q+ ++ Y E + P NL I ++ C L Sbjct: 1158 PIPLVSYLSIKEVSAFPTLVIKQRKFTIKYSELSEMDGRIFPFHNLKSITSMRLENCPNL 1217 Query: 571 VFHRPSGLSDLIS 609 +++ S LI+ Sbjct: 1218 IYNWSEAFSQLIA 1230 >12_01_0686 - 5855216-5858263 Length = 1015 Score = 29.9 bits (64), Expect = 2.0 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 3/80 (3%) Frame = +1 Query: 406 LAVAVIRFVAIFPAPVTSQQFYSFIYVAYIEPYSSLPP-ASNLPGILFIQDHRCRLVFHR 582 L + F P+ + S + + V+ + S+P SNL + +Q C L H Sbjct: 367 LGIGASGFSGTLPSSLGSFLYLDLLEVSGFQIVGSMPSWISNLTSLTVLQFSNCGLSGHV 426 Query: 583 PSGLSDL--ISKLSTFFIKF 636 PS + +L + KL+ + KF Sbjct: 427 PSSIGNLRELIKLALYNCKF 446 >09_03_0144 - 12728697-12729238,12729312-12729432 Length = 220 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = -1 Query: 222 KVLQINIDRGKAAHDLLLATASSMSAD 142 K L+++ DR +AAHD LLA ++++AD Sbjct: 148 KQLELDFDRLRAAHDELLAGRTALAAD 174 >01_03_0282 - 14580875-14580891,14582126-14585855 Length = 1248 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 1/69 (1%) Frame = +1 Query: 478 IYVAYIEPYSSLPPA-SNLPGILFIQDHRCRLVFHRPSGLSDLISKLSTFFIKFVDXKSS 654 +Y++ + SL P NLP + + +RC+ + P G S L T IK+ S Sbjct: 1158 LYISDCKNLRSLGPCLGNLPSLTSLSIYRCKSLVSLPDG-PGAYSSLETLEIKYCPAMKS 1216 Query: 655 LTSSISNEL 681 L + L Sbjct: 1217 LPGRLQQRL 1225 >10_02_0188 - 6473353-6473432,6473619-6474816 Length = 425 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 414 DGEDRSRACRRCSEAGHMAGDCVNEQFCPLCNK 316 + E +AC RC E GH+A C C C + Sbjct: 185 EDEMERKACSRCGEIGHVASSCAT--ICVHCEE 215 >09_02_0546 - 10454404-10455687 Length = 427 Score = 29.5 bits (63), Expect = 2.6 Identities = 18/57 (31%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = -1 Query: 474 RIELLRCYRCWKYGHKADNCDGEDRSRACRRCSEAGHMAGDCVNEQF-CPLCNKKGH 307 +IEL C RC + GH A +C + C C E H C + C C H Sbjct: 197 KIELKACSRCGEIGHVASSC-----ASTCVHCEE-DHPPDRCPTSRITCFFCEGTDH 247 >05_01_0553 + 4849535-4849553,4850727-4851913 Length = 401 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -1 Query: 432 HKADNCDGEDRSRACRRCSEAGHMAGDC 349 H ++ G +R C C E GH DC Sbjct: 125 HYSNKSSGRHSARVCYVCKEPGHFIADC 152 >02_02_0178 + 7490447-7490659,7490996-7491112,7491337-7491517, 7491594-7491679,7491785-7491889,7492059-7492121, 7492404-7492513,7492644-7492763,7492833-7492908, 7493254-7493327,7493474-7493594,7495559-7495656, 7495735-7495858,7496373-7496504 Length = 539 Score = 29.1 bits (62), Expect = 3.5 Identities = 20/49 (40%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +1 Query: 472 SFIYVAYIEPYSSLPPASNLPGILF-IQDHRCRLVFHRPSGLSDLISKL 615 SF+ VAY+ Y SLP S L G F I H P GL D+I + Sbjct: 162 SFVEVAYLLMYGSLPTQSQLAGWEFAISQHSA-----VPQGLLDIIQAM 205 >08_02_0699 + 20155509-20156189 Length = 226 Score = 28.7 bits (61), Expect = 4.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -1 Query: 459 RCYRCWKYGHKADNCDG 409 RC+RC K GH NC G Sbjct: 210 RCWRCGKPGHHTSNCMG 226 >05_04_0281 + 19779156-19779805,19781303-19781475,19781909-19782162, 19782265-19782339,19782431-19782538,19782914-19783031, 19783347-19783482,19785623-19785797,19786333-19786860, 19787624-19787836,19787850-19787882 Length = 820 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -1 Query: 402 RSRACRRCSEAGHMAGDCVNEQFCPLCNK 316 R R C RC+ A + D V +++C C K Sbjct: 189 RHRVCLRCAHAAAVMLDGVQKRYCQQCGK 217 >01_06_1507 - 37838645-37839311,37839393-37839499,37839588-37839663, 37839747-37839869,37840051-37840208,37840311-37840385, 37840466-37840506,37840594-37840670,37840755-37840883, 37840990-37841060,37841237-37841332,37841489-37841584, 37841681-37841953,37842871-37842957,37843101-37843178, 37843350-37843514,37843622-37843768,37843921-37843983, 37844082-37844201,37844352-37844543,37844672-37844748, 37845094-37845196,37845684-37845887 Length = 1074 Score = 28.7 bits (61), Expect = 4.6 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -1 Query: 459 RCYRCWKYGHKADNCDGEDRSRA 391 +C+ C + GH A NC+G+ + +A Sbjct: 263 KCFLCGQVGHLAANCEGKVKRKA 285 >10_06_0142 - 11175732-11176545,11176924-11177450,11177544-11177761, 11177916-11177961,11178203-11178253 Length = 551 Score = 28.3 bits (60), Expect = 6.1 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 5/55 (9%) Frame = +1 Query: 298 ASCVSFFIT--QGTELLI---YAISGHMARFRTPPTCPTPILAVAVIRFVAIFPA 447 AS V FF+ Q T LI A+ G + RF PP VAV+ + ++ A Sbjct: 325 ASLVGFFMVTAQMTSTLIEQGVAMDGRVGRFTVPPASLATFDVVAVLALIPVYDA 379 >10_04_0004 + 7389321-7390013 Length = 230 Score = 28.3 bits (60), Expect = 6.1 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -1 Query: 432 HKADNCDGEDRSRACRRCSEAGHMAGDC 349 H + + SR CR C + GH DC Sbjct: 47 HNQEPAPRDQASRFCRNCRKPGHRFSDC 74 >09_06_0188 - 21441377-21442201 Length = 274 Score = 28.3 bits (60), Expect = 6.1 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 4/43 (9%) Frame = -1 Query: 405 DRSRACRRCSEAGHMAGDCVNEQFCPL----CNKKGHTAGTSG 289 D+SR C C E GH++ +C Q P +KK G SG Sbjct: 163 DKSR-CYECGEEGHLSYECPRNQLGPRERPPPSKKSRRGGGSG 204 >07_03_0964 - 22989470-22989618,22989729-22990476 Length = 298 Score = 28.3 bits (60), Expect = 6.1 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = -1 Query: 456 CYRCWKYGHKADNC-DGEDRSRACRRCSEAGHMAGDCVNEQFCPLCNKKGHTAGTSGC 286 C+ C K GH A +C + +DR A SE G +G E+F L + K G S C Sbjct: 214 CFVCGKSGHWAKDCPERKDRKSANMIISEGGGTSG-YGRERFL-LVDGKRVACGCSWC 269 >06_03_0767 - 24436161-24436460 Length = 99 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -2 Query: 605 IRSLRPDGRWKTRRQR*SWMKRMPGRLLAGGKEE*GSI 492 + +LRP RW+ RR+R K P R GG+ GS+ Sbjct: 11 VDALRPGARWRRRREREKRRKPNP-RFGRGGERGKGSV 47 >04_03_0151 + 11905926-11906618 Length = 230 Score = 28.3 bits (60), Expect = 6.1 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -1 Query: 432 HKADNCDGEDRSRACRRCSEAGHMAGDC 349 H + SR+CR C + GH DC Sbjct: 47 HNQKPAPWDQASRSCRNCRKPGHCFSDC 74 >01_04_0136 + 16506747-16506982,16507128-16507728,16510443-16510842, 16513595-16513709,16513776-16514352 Length = 642 Score = 28.3 bits (60), Expect = 6.1 Identities = 26/98 (26%), Positives = 35/98 (35%) Frame = +1 Query: 343 IYAISGHMARFRTPPTCPTPILAVAVIRFVAIFPAPVTSQQFYSFIYVAYIEPYSSLPPA 522 IY +S F PP P PIL I P + + SF + PY L Sbjct: 6 IYQLSAPRGEFYEPPPSPKPILTSG----YEIRPKIINMIRVKSFSGLDQENPYHHLREF 61 Query: 523 SNLPGILFIQDHRCRLVFHRPSGLSDLISKLSTFFIKF 636 L L IQD ++ + S L S + +F Sbjct: 62 EELCSCLMIQDMTQEIIRYISSVFGRLKKNQSIAWARF 99 >12_02_0541 + 20162313-20162374,20162670-20163419,20164627-20164820, 20165001-20165074,20165094-20165114 Length = 366 Score = 27.9 bits (59), Expect = 8.0 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 456 CYRCWKYGHKADNC 415 C+ C +YGH A+NC Sbjct: 295 CFNCGEYGHYANNC 308 >06_03_0062 + 16116893-16117029,16117472-16117760 Length = 141 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -1 Query: 585 WAVENQTATVILDEEDARKVACGW*GRVG 499 WAVE++ A V+ E+ R + GW G+ G Sbjct: 31 WAVESEHARVVNPEQRWRARSTGWLGKKG 59 >05_07_0246 + 28634530-28634735,28634841-28634901,28634996-28635088, 28635326-28635391,28635506-28635576,28636225-28636329, 28637065-28637134 Length = 223 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 300 QLCVLFYYTGDRIAHLRNLRPYGPLPN 380 Q+ VL + R H+R ++ YGP PN Sbjct: 176 QISVLSNHLNGRDTHIRQIKIYGPRPN 202 >05_03_0382 + 13342764-13342958,13343178-13343278,13343373-13343459, 13343559-13343709,13343826-13344116,13346058-13346197, 13346276-13346467,13346559-13346631,13346708-13346852, 13347017-13347124,13347213-13347306,13348245-13348324, 13348665-13348738,13349236-13349253 Length = 582 Score = 27.9 bits (59), Expect = 8.0 Identities = 17/71 (23%), Positives = 31/71 (43%), Gaps = 2/71 (2%) Frame = -1 Query: 456 CYRCW--KYGHKADNCDGEDRSRACRRCSEAGHMAGDCVNEQFCPLCNKKGHTAGTSGCS 283 C +C +YG +A+ D + C +C + + + C+ ++ P H A SGC+ Sbjct: 92 CRKCLFNRYGQEAEKV-ANDGTWTCPKCKDICNCSF-CMKKKGLPPTGILAHAAKASGCA 149 Query: 282 LFREALETASE 250 L+ E Sbjct: 150 SVHHLLKKGKE 160 >05_01_0112 - 757514-758444,758525-758571,759074-759236,759861-760366 Length = 548 Score = 27.9 bits (59), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 402 RSRACRRCSEAGHMAGDCVNE 340 + R C C AGH+A +C N+ Sbjct: 526 KRRTCYECGIAGHLASECPNK 546 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,584,723 Number of Sequences: 37544 Number of extensions: 436761 Number of successful extensions: 1656 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 1444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1636 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -