BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0152 (756 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 26 1.1 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 26 1.4 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 25 1.9 AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding pr... 23 7.7 AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding pr... 23 7.7 AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding pr... 23 7.7 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 26.2 bits (55), Expect = 1.1 Identities = 9/26 (34%), Positives = 11/26 (42%) Frame = +1 Query: 250 RSPAVYTTAQHRSHKYRSSRGHHEHP 327 + P+ Y QH H HH HP Sbjct: 167 QQPSSYHQQQHPGHSQHHHHHHHHHP 192 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 25.8 bits (54), Expect = 1.4 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -1 Query: 411 NPPRVPSLRGQVSPLSLHASDSGRGNGIGMFMMT 310 +PP P+L Q SP S D G+ N G+ T Sbjct: 301 DPPPTPALTAQFSPESFSYQDCGQLNLNGVVQRT 334 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 25.4 bits (53), Expect = 1.9 Identities = 9/26 (34%), Positives = 11/26 (42%) Frame = +1 Query: 271 TAQHRSHKYRSSRGHHEHPDTVPPAG 348 T H +H + HH HP AG Sbjct: 495 THSHHAHPHHHHHHHHHHPTAADLAG 520 >AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding protein AgamOBP30 protein. Length = 289 Score = 23.4 bits (48), Expect = 7.7 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -2 Query: 233 LQYTMTGRLFASAHRHVVDCR*FGPAILEEFSLSTG 126 LQY M R F+ A HV +L + L TG Sbjct: 186 LQYPMPDRSFSCAKTHVAGAEGDFDCVLRCYMLRTG 221 >AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding protein OBPjj83c protein. Length = 273 Score = 23.4 bits (48), Expect = 7.7 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -2 Query: 233 LQYTMTGRLFASAHRHVVDCR*FGPAILEEFSLSTG 126 LQY M R F+ A HV +L + L TG Sbjct: 170 LQYPMPDRSFSCAKTHVAGAEGDFDCVLRCYMLRTG 205 >AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding protein 1 protein. Length = 289 Score = 23.4 bits (48), Expect = 7.7 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -2 Query: 233 LQYTMTGRLFASAHRHVVDCR*FGPAILEEFSLSTG 126 LQY M R F+ A HV +L + L TG Sbjct: 186 LQYPMPDRSFSCAKTHVAGAEGDFDCVLRCYMLRTG 221 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 782,676 Number of Sequences: 2352 Number of extensions: 16213 Number of successful extensions: 27 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -