BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0152 (756 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 25 0.77 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 25 1.0 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 25 1.0 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 25 1.0 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 25 1.0 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 24 1.8 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 24 1.8 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 24 1.8 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 24 1.8 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 24 1.8 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 24 1.8 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 24 1.8 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 24 1.8 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 3.1 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 5.4 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 5.4 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 7.1 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 7.1 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 7.1 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 7.1 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 9.4 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 9.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.4 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 9.4 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 25.0 bits (52), Expect = 0.77 Identities = 12/61 (19%), Positives = 30/61 (49%) Frame = +2 Query: 164 QTSDSPQRDGERMRRVVQSLYTEEKHRRHDRLQFTPLHNIDRINTEVHGVIMNIPIPFPL 343 ++ D +R+ + +++ SL + H ++ + +NI+ I + +P+P P+ Sbjct: 66 RSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNINYIEQ------IPVPVPIPV 119 Query: 344 P 346 P Sbjct: 120 P 120 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.6 bits (51), Expect = 1.0 Identities = 12/61 (19%), Positives = 30/61 (49%) Frame = +2 Query: 164 QTSDSPQRDGERMRRVVQSLYTEEKHRRHDRLQFTPLHNIDRINTEVHGVIMNIPIPFPL 343 ++ D +R+ + +++ SL + H ++ + +NI+ I + +P+P P+ Sbjct: 66 RSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNINYIEQ------IPVPVPVPV 119 Query: 344 P 346 P Sbjct: 120 P 120 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.6 bits (51), Expect = 1.0 Identities = 12/61 (19%), Positives = 30/61 (49%) Frame = +2 Query: 164 QTSDSPQRDGERMRRVVQSLYTEEKHRRHDRLQFTPLHNIDRINTEVHGVIMNIPIPFPL 343 ++ D +R+ + +++ SL + H ++ + +NI+ I + +P+P P+ Sbjct: 66 RSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNINYIEQ------IPVPVPVPV 119 Query: 344 P 346 P Sbjct: 120 P 120 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.6 bits (51), Expect = 1.0 Identities = 12/61 (19%), Positives = 30/61 (49%) Frame = +2 Query: 164 QTSDSPQRDGERMRRVVQSLYTEEKHRRHDRLQFTPLHNIDRINTEVHGVIMNIPIPFPL 343 ++ D +R+ + +++ SL + H ++ + +NI+ I + +P+P P+ Sbjct: 66 RSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNINYIEQ------IPVPVPVPV 119 Query: 344 P 346 P Sbjct: 120 P 120 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 24.6 bits (51), Expect = 1.0 Identities = 12/61 (19%), Positives = 30/61 (49%) Frame = +2 Query: 164 QTSDSPQRDGERMRRVVQSLYTEEKHRRHDRLQFTPLHNIDRINTEVHGVIMNIPIPFPL 343 ++ D +R+ + +++ SL + H ++ + +NI+ I + +P+P P+ Sbjct: 299 RSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNINYIEQ------IPVPVPVPV 352 Query: 344 P 346 P Sbjct: 353 P 353 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 194 ERMRRVVQSLYTEEKHRRHDRLQ 262 ER+RR + + +E+ R H+RL+ Sbjct: 34 ERLRRRREWMIQQEREREHERLK 56 Score = 21.8 bits (44), Expect = 7.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 158 RVQTSDSPQRDGERMRRVVQSLYTEEKHRRHDRL 259 R + +S + DGER +S ++K RR+D+L Sbjct: 238 RHEDRNSYRNDGERSCSRDRSREYKKKDRRYDQL 271 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 194 ERMRRVVQSLYTEEKHRRHDRLQ 262 ER+RR + + +E+ R H+RL+ Sbjct: 34 ERLRRRREWMIQQEREREHERLK 56 Score = 21.8 bits (44), Expect = 7.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 158 RVQTSDSPQRDGERMRRVVQSLYTEEKHRRHDRL 259 R + +S + DGER +S ++K RR+D+L Sbjct: 238 RHEDRNSYRNDGERSCSRDRSREYKKKDRRYDQL 271 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 194 ERMRRVVQSLYTEEKHRRHDRLQ 262 ER+RR + + +E+ R H+RL+ Sbjct: 34 ERLRRRREWMIQQEREREHERLK 56 Score = 21.8 bits (44), Expect = 7.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 158 RVQTSDSPQRDGERMRRVVQSLYTEEKHRRHDRL 259 R + +S + DGER +S ++K RR+D+L Sbjct: 238 RHEDRNSYRNDGERSCSRDRSREYKKKDRRYDQL 271 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 194 ERMRRVVQSLYTEEKHRRHDRLQ 262 ER+RR + + +E+ R H+RL+ Sbjct: 34 ERLRRRREWMIQQEREREHERLK 56 Score = 21.8 bits (44), Expect = 7.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 158 RVQTSDSPQRDGERMRRVVQSLYTEEKHRRHDRL 259 R + +S + DGER +S ++K RR+D+L Sbjct: 238 RHEDRNSYRNDGERSCSRDRSREYKKKDRRYDQL 271 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 194 ERMRRVVQSLYTEEKHRRHDRLQ 262 ER+RR + + +E+ R H+RL+ Sbjct: 34 ERLRRRREWMIQQEREREHERLK 56 Score = 21.8 bits (44), Expect = 7.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 158 RVQTSDSPQRDGERMRRVVQSLYTEEKHRRHDRL 259 R + +S + DGER +S ++K RR+D+L Sbjct: 238 RHEDRNSYRNDGERSCSRDRSREYKKKDRRYDQL 271 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 194 ERMRRVVQSLYTEEKHRRHDRLQ 262 ER+RR + + +E+ R H+RL+ Sbjct: 34 ERLRRRREWMIQQEREREHERLK 56 Score = 22.2 bits (45), Expect = 5.4 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 158 RVQTSDSPQRDGERMRRVVQSLYTEEKHRRHDRL 259 R + +S + DGER +S ++K RR+D+L Sbjct: 238 RHEDGNSYRNDGERSCSRDRSREYKKKDRRYDQL 271 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 194 ERMRRVVQSLYTEEKHRRHDRLQ 262 ER+RR + + +E+ R H+RL+ Sbjct: 34 ERLRRRREWMIQQEREREHERLK 56 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 194 ERMRRVVQSLYTEEKHRRHDRLQ 262 ER+RR + + +E+ R H+RL+ Sbjct: 34 ERLRRRREWMIQQEREREHERLK 56 Score = 21.8 bits (44), Expect = 7.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 158 RVQTSDSPQRDGERMRRVVQSLYTEEKHRRHDRL 259 R + +S + DGER +S ++K RR+D+L Sbjct: 238 RHEDRNSYRNDGERSCSRDRSREYKKKDRRYDQL 271 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.0 bits (47), Expect = 3.1 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -1 Query: 627 PNLQNYCLSVTALSLKNLTKIFL*SNKVGKYYLD 526 P N L +LKN + L ++++G+ YLD Sbjct: 1017 PKTLNEVLQADMNALKNFNQPLLVNDQLGQLYLD 1050 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 5.4 Identities = 7/27 (25%), Positives = 14/27 (51%) Frame = -2 Query: 497 KSPMFTLELPLYFHCHLRIRLQDRQCC 417 + P T+ + HC L ++ + + CC Sbjct: 375 RQPEDTMSVDRMQHCELHMQPRKKNCC 401 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 5.4 Identities = 7/27 (25%), Positives = 14/27 (51%) Frame = -2 Query: 497 KSPMFTLELPLYFHCHLRIRLQDRQCC 417 + P T+ + HC L ++ + + CC Sbjct: 375 RQPEDTMSVDRMQHCELHMQPRKKNCC 401 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 523 VLAFIERKLSRPCS 482 V F+ RKL RPC+ Sbjct: 64 VAVFLVRKLRRPCN 77 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 7.1 Identities = 6/23 (26%), Positives = 15/23 (65%) Frame = +3 Query: 408 DYKATLPILKSYPKVTVEVKWEL 476 D+ TLP+ + P++ + +W++ Sbjct: 499 DFAKTLPLPQHLPRIHHDAEWKV 521 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.8 bits (44), Expect = 7.1 Identities = 6/23 (26%), Positives = 15/23 (65%) Frame = +3 Query: 408 DYKATLPILKSYPKVTVEVKWEL 476 D+ TLP+ + P++ + +W++ Sbjct: 414 DFAKTLPLPQHLPRIHHDAEWKV 436 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 7.1 Identities = 6/23 (26%), Positives = 15/23 (65%) Frame = +3 Query: 408 DYKATLPILKSYPKVTVEVKWEL 476 D+ TLP+ + P++ + +W++ Sbjct: 733 DFAKTLPLPQHLPRIHHDAEWKV 755 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.4 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -1 Query: 468 TLLPLSP*DKTSG*AVLLYNPPRVPSLR--GQVSPLS--LHASDSGRGNGIGM 322 T LP++P DK G LY VP+ R Q P+ +H G+GI M Sbjct: 89 TQLPVNPRDKIEGAEDCLYLNVYVPADRTPSQSLPVIFWIHGGAFQFGSGIPM 141 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +3 Query: 243 DATIACSLHHCTTSIA*IQKFT 308 DA I C+++ CT+ ++ I F+ Sbjct: 314 DALIVCTVNSCTSMLSGIVIFS 335 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +3 Query: 243 DATIACSLHHCTTSIA*IQKFT 308 DA I C+++ CT+ ++ I F+ Sbjct: 367 DALIVCTVNSCTSMLSGIVIFS 388 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.4 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -1 Query: 468 TLLPLSP*DKTSG*AVLLYNPPRVPSLR--GQVSPLS--LHASDSGRGNGIGM 322 T LP++P DK G LY VP+ R Q P+ +H G+GI M Sbjct: 89 TQLPVNPRDKIEGAEDCLYLNVYVPADRTPSQSLPVIFWIHGGAFQFGSGIPM 141 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,039 Number of Sequences: 438 Number of extensions: 4338 Number of successful extensions: 32 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -