BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0150 (772 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0012 + 19251085-19251666 28 7.2 05_03_0155 - 9002049-9002134,9002825-9004139 28 9.5 >11_06_0012 + 19251085-19251666 Length = 193 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 456 WLTGS*AGYVGTWPDGTMXS 515 WLTG+ AG G WP G + S Sbjct: 136 WLTGAVAGQRGRWPAGAVAS 155 >05_03_0155 - 9002049-9002134,9002825-9004139 Length = 466 Score = 27.9 bits (59), Expect = 9.5 Identities = 20/62 (32%), Positives = 27/62 (43%) Frame = +3 Query: 192 TDXQTIHTSNNKTPDXKIVKMLTYWSXSGTXYIXXQVASSXSGKKRGLXPSDAPLVRDSD 371 T T + + PD V ML S SGT ++ ++ + K PS PLVR D Sbjct: 194 TGLLTRSAAGHGPPDSYAVAMLREHSNSGTFHMWRFLSRTGKWDKIDGLPSPLPLVRRLD 253 Query: 372 *D 377 D Sbjct: 254 ID 255 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,745,701 Number of Sequences: 37544 Number of extensions: 174129 Number of successful extensions: 247 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 246 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 247 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2075009728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -