BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0150 (772 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 23 3.1 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 7.3 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 7.3 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 21 9.6 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -1 Query: 502 PSGHVPTYPAQEPVSQXLSAPSTXLSQSCD 413 P VP+YP +E +++ + T + CD Sbjct: 313 PIKFVPSYPFEEDINEGSNYMQTRVPAWCD 342 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 7.3 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +2 Query: 449 KXLAHWFLSWICRHVAGWXXGXK*RLCXXG 538 K L + + W HV GW G LC G Sbjct: 518 KYLTYEYPWW--SHVLGWLCGLSSMLCIPG 545 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 7.3 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +2 Query: 449 KXLAHWFLSWICRHVAGWXXGXK*RLCXXG 538 K L + + W HV GW G LC G Sbjct: 571 KYLTYEYPWW--SHVLGWLCGLSSMLCIPG 598 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 21.4 bits (43), Expect = 9.6 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = -2 Query: 333 TRASFHCXSMPLVVECXWFLXWT 265 TRA M +++ +F+ WT Sbjct: 252 TRAKIRTLKMTVIIIAVFFICWT 274 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,050 Number of Sequences: 438 Number of extensions: 1732 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -