BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0147 (772 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC31G5.07 |||conjugation protein |Schizosaccharomyces pombe|ch... 27 3.0 SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit Srb9... 27 3.9 SPAC17G8.13c |mst2||histone acetyltransferase Mst2|Schizosacchar... 27 3.9 SPBPJ4664.06 |gpt1||UDP-glucose-glycoprotein glucosyltransferase... 26 6.9 SPBC3H7.02 |||sulfate transporter |Schizosaccharomyces pombe|chr... 25 9.1 SPAC25B8.16 |||RNase P and RNase MRP subunit |Schizosaccharomyce... 25 9.1 SPBC577.05c |rec27|mug41|meiotic recombination protein Rec27|Sch... 25 9.1 >SPAC31G5.07 |||conjugation protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 234 Score = 27.1 bits (57), Expect = 3.0 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -3 Query: 569 QRTGSLAALVIFIIKALLMTCCQ 501 Q TG+L L +I+ AL+MT CQ Sbjct: 9 QGTGTLCTLAAWILLALVMTGCQ 31 >SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit Srb9|Schizosaccharomyces pombe|chr 1|||Manual Length = 1223 Score = 26.6 bits (56), Expect = 3.9 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 556 DPVLWKYYGITVTDDNLVVIDWRKGVRRSLFPKRCYVYFMEDVD 687 D LW YG V D L V+ + + L P R VY + +VD Sbjct: 184 DTQLWNIYGYPVVDLQLSVLS-KGHIEFYLKPTRQTVYRLSEVD 226 >SPAC17G8.13c |mst2||histone acetyltransferase Mst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 407 Score = 26.6 bits (56), Expect = 3.9 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +2 Query: 170 AKEYNIEKSCDKYMNVDVVKQFMEMYKMACS 262 AK I +SC KYMN D V ++ +KM CS Sbjct: 128 AKNLYICESCLKYMNSDHV---LQRHKMKCS 155 >SPBPJ4664.06 |gpt1||UDP-glucose-glycoprotein glucosyltransferase Gpt1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1448 Score = 25.8 bits (54), Expect = 6.9 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +2 Query: 56 VFTKEPMVNLDMKMKELCIMKLLDHILQPTMFEDIKEIAKEYNIE 190 + TK + + D K+K +++ L P+ I IAK+YN E Sbjct: 1174 IMTKSVIEHTDKKVK----FWFIENFLSPSFKSSIPAIAKKYNFE 1214 >SPBC3H7.02 |||sulfate transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 877 Score = 25.4 bits (53), Expect = 9.1 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 11/87 (12%) Frame = -2 Query: 471 AGQVETLAVG---SVEARGSKSVDEHASVDPFSHPARSPHENIEVLSVVEDSE------- 322 AG V ++ +V RG+ ++ + AS P++ PA +N VED+ Sbjct: 618 AGHVNSMLTSKAKTVTRRGNANIYKKASDRPWNDPAPRKKKNAPE---VEDTRPLLRAII 674 Query: 321 -DFDGFFHLELVGVDEGLSTREHAILY 244 DF H++ GV + TR+ +Y Sbjct: 675 LDFSAVNHIDTTGVQALVDTRKELEIY 701 >SPAC25B8.16 |||RNase P and RNase MRP subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 698 Score = 25.4 bits (53), Expect = 9.1 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +1 Query: 568 WKYY-GITVTDDNLVVIDWR 624 W Y GI V DD + + DWR Sbjct: 317 WNYLSGIAVLDDRIAMHDWR 336 >SPBC577.05c |rec27|mug41|meiotic recombination protein Rec27|Schizosaccharomyces pombe|chr 2|||Manual Length = 134 Score = 25.4 bits (53), Expect = 9.1 Identities = 9/36 (25%), Positives = 22/36 (61%) Frame = +2 Query: 77 VNLDMKMKELCIMKLLDHILQPTMFEDIKEIAKEYN 184 VNL K ++ ++++H+L+ ++I+ K+Y+ Sbjct: 12 VNLKKKQLQITSSEIIEHVLEELNLKNIERRVKKYD 47 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,826,036 Number of Sequences: 5004 Number of extensions: 54279 Number of successful extensions: 161 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 161 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 371330890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -