BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0147 (772 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC146771-1|AAI46772.1| 1649|Homo sapiens CTD-binding SR-like pro... 33 1.1 AB040975-1|BAA96066.1| 1654|Homo sapiens KIAA1542 protein protein. 33 1.1 >BC146771-1|AAI46772.1| 1649|Homo sapiens CTD-binding SR-like protein rA9 protein. Length = 1649 Score = 33.1 bits (72), Expect = 1.1 Identities = 24/62 (38%), Positives = 28/62 (45%) Frame = -2 Query: 471 AGQVETLAVGSVEARGSKSVDEHASVDPFSHPARSPHENIEVLSVVEDSEDFDGFFHLEL 292 AG E +VGS G S EH S E++E S EDSED DG LE+ Sbjct: 28 AGDFEESSVGSSGDSGDDSDSEHGDGTDGEDEGASEEEDLEDRSGSEDSED-DGETLLEV 86 Query: 291 VG 286 G Sbjct: 87 AG 88 >AB040975-1|BAA96066.1| 1654|Homo sapiens KIAA1542 protein protein. Length = 1654 Score = 33.1 bits (72), Expect = 1.1 Identities = 24/62 (38%), Positives = 28/62 (45%) Frame = -2 Query: 471 AGQVETLAVGSVEARGSKSVDEHASVDPFSHPARSPHENIEVLSVVEDSEDFDGFFHLEL 292 AG E +VGS G S EH S E++E S EDSED DG LE+ Sbjct: 33 AGDFEESSVGSSGDSGDDSDSEHGDGTDGEDEGASEEEDLEDRSGSEDSED-DGETLLEV 91 Query: 291 VG 286 G Sbjct: 92 AG 93 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,411,749 Number of Sequences: 237096 Number of extensions: 2054735 Number of successful extensions: 4351 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4224 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4351 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9311505506 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -