BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0147 (772 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006644-6|AAZ91358.1| 958|Caenorhabditis elegans Hypothetical ... 30 2.1 Z77657-6|CAB01150.2| 607|Caenorhabditis elegans Hypothetical pr... 29 3.7 AL132949-27|CAB61105.1| 209|Caenorhabditis elegans Hypothetical... 29 3.7 Z80217-2|CAB02288.1| 209|Caenorhabditis elegans Hypothetical pr... 28 6.4 Z75541-6|CAA99857.2| 644|Caenorhabditis elegans Hypothetical pr... 28 8.5 AF440800-1|AAL28139.1| 644|Caenorhabditis elegans transcription... 28 8.5 AF047660-1|AAC04431.1| 900|Caenorhabditis elegans Osm-9 and cap... 28 8.5 >AC006644-6|AAZ91358.1| 958|Caenorhabditis elegans Hypothetical protein F55A3.1 protein. Length = 958 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 294 LVGVDEGLSTREHAILYISMNCLTTSTFMY 205 L+G+D L EH IS+N L T+TF Y Sbjct: 406 LLGLDGSLIFLEHVFWVISLNTLFTATFAY 435 >Z77657-6|CAB01150.2| 607|Caenorhabditis elegans Hypothetical protein F08H9.1 protein. Length = 607 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -2 Query: 372 RSPHENIEVLSVVEDSEDFD 313 R+P+ENI++L +DSED D Sbjct: 581 RAPYENIDLLLSTDDSEDID 600 >AL132949-27|CAB61105.1| 209|Caenorhabditis elegans Hypothetical protein Y53F4B.31 protein. Length = 209 Score = 29.1 bits (62), Expect = 3.7 Identities = 18/72 (25%), Positives = 34/72 (47%) Frame = -2 Query: 468 GQVETLAVGSVEARGSKSVDEHASVDPFSHPARSPHENIEVLSVVEDSEDFDGFFHLELV 289 GQV L V + S ++ + + + F + ++P E + ++V+ +DF G F ++ Sbjct: 51 GQVPYLTVDGFDIPQSAAIIRYLA-NKFGYAGKTPEEQVWADAIVDQFKDFMGSFRERIM 109 Query: 288 GVDEGLSTREHA 253 G S E A Sbjct: 110 AHFAGKSQEEIA 121 >Z80217-2|CAB02288.1| 209|Caenorhabditis elegans Hypothetical protein F37B1.2 protein. Length = 209 Score = 28.3 bits (60), Expect = 6.4 Identities = 19/70 (27%), Positives = 31/70 (44%) Frame = -2 Query: 468 GQVETLAVGSVEARGSKSVDEHASVDPFSHPARSPHENIEVLSVVEDSEDFDGFFHLELV 289 GQ+ L V E S ++ + + F ++P E V +VV+ +DF G F ++ Sbjct: 51 GQMPVLNVDGFEIPQSAAITRYLA-RKFGFAGKTPEEEAWVDAVVDQFKDFFGEFRKLII 109 Query: 288 GVDEGLSTRE 259 G S E Sbjct: 110 AQRAGKSVEE 119 >Z75541-6|CAA99857.2| 644|Caenorhabditis elegans Hypothetical protein F52B5.5a protein. Length = 644 Score = 27.9 bits (59), Expect = 8.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +2 Query: 167 IAKEYNIEKSCDKYMNVDVVKQ 232 + + N+ + C+K+M +DV+KQ Sbjct: 212 VQSDMNLNEDCEKWMEIDVLKQ 233 >AF440800-1|AAL28139.1| 644|Caenorhabditis elegans transcription factor CEP-1 protein. Length = 644 Score = 27.9 bits (59), Expect = 8.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +2 Query: 167 IAKEYNIEKSCDKYMNVDVVKQ 232 + + N+ + C+K+M +DV+KQ Sbjct: 212 VQSDMNLNEDCEKWMEIDVLKQ 233 >AF047660-1|AAC04431.1| 900|Caenorhabditis elegans Osm-9 and capsaicin receptor-relatedprotein 2 protein. Length = 900 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/44 (25%), Positives = 26/44 (59%) Frame = -2 Query: 273 LSTREHAILYISMNCLTTSTFMYLSQLFSMLYSLAISLMSSNMV 142 L+ E +LY ++ +T +++ ++ +L+ L +S+M NM+ Sbjct: 716 LTIGEFTVLYRNLALCPANTMVWIGKVVFILFELFVSIMQFNML 759 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,898,480 Number of Sequences: 27780 Number of extensions: 319834 Number of successful extensions: 763 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 763 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1851132448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -