BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0144 (780 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory pro... 25 0.90 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 2.7 >DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory protein 1 protein. Length = 112 Score = 24.6 bits (51), Expect = 0.90 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +3 Query: 333 QRRCRSGESPPEPLGR 380 Q +C +GE+P +P+GR Sbjct: 48 QLKCATGEAPCDPVGR 63 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -2 Query: 290 WLESNFSIPSNKTSGSSQWQRLQQTEAQSFHW 195 WL+SN S+ + + S Q T+ SF++ Sbjct: 13 WLKSNSSLAGFEVNSSEQLTTPTPTDINSFYF 44 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,575 Number of Sequences: 336 Number of extensions: 3517 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21065107 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -