BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0144 (780 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 25 2.0 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 24 4.6 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 25.4 bits (53), Expect = 2.0 Identities = 22/69 (31%), Positives = 25/69 (36%), Gaps = 2/69 (2%) Frame = +3 Query: 288 PAEAHRDSGEEPASGQRRCRSGESPPEPLGRSRTLRQDSDEAHDDGRKESTAP--DRSYR 461 PA D+ G+ G S G + D DE H GRK AP R Sbjct: 616 PAGYREDTTGSYKYGKLSSSGGASSTTHSGAPSRSQSDEDEQHSVGRK-GLAPLIQRGEG 674 Query: 462 SGEGKEQIP 488 S EGK P Sbjct: 675 SFEGKAMPP 683 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 24.2 bits (50), Expect = 4.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 221 QTEAQSFHWCRRHGD 177 QT +Q+ HW + HGD Sbjct: 222 QTLSQANHWLKSHGD 236 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 752,012 Number of Sequences: 2352 Number of extensions: 14904 Number of successful extensions: 31 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -