BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0143 (725 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 24 4.2 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 23 7.3 AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase p... 23 9.6 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 24.2 bits (50), Expect = 4.2 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +1 Query: 388 KTRGLHQRAA-LPSQGSS*GR*EDQVDPGTADRGSVQ 495 +TR + +R LP +G+ G PGT DR S+Q Sbjct: 2 ETRSMRKRTTRLPEEGAPTG-----AGPGTGDRASIQ 33 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 23.4 bits (48), Expect = 7.3 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +2 Query: 305 SRIRSEQTNNFIVATKEAL-DAKXETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQT 481 S+ R + + + +E L DAK + HE+ R E+ K + GV + + Q T Sbjct: 476 SKERIHELQSELDNVREQLGDAKIDKHEDARRKKKQEVVELFKLEVPGVYDRMINMCQPT 535 Query: 482 AEVY 493 + Y Sbjct: 536 HKRY 539 >AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.0 bits (47), Expect = 9.6 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -2 Query: 154 TPTGSASITSYARPPFDISWQRISVDLVSTSMAST 50 TP S+ +ARP +++ +S+ +T +A T Sbjct: 650 TPNSVGSLQEFARPYRNMATTPVSIRFTNTVIART 684 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 580,567 Number of Sequences: 2352 Number of extensions: 9580 Number of successful extensions: 27 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -