BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0142 (770 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. 25 1.0 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 4.2 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 5.5 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 22 7.3 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 7.3 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 7.3 >DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. Length = 160 Score = 24.6 bits (51), Expect = 1.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 470 STGKCSSKSSYILCENM*LNPESDDTGEQT 381 ST KC + ++I+C + L+ +DT E T Sbjct: 124 STDKCENGLNFIICFSKLLSDMYEDTFEDT 153 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 22.6 bits (46), Expect = 4.2 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -2 Query: 205 DDSRLFSGRQRLRKTQLRINATPLVTQSRF 116 + LFS +Q+ + +++ TP V SRF Sbjct: 510 ETKELFSSQQKTKNNLMKLETTP-VLPSRF 538 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 22.2 bits (45), Expect = 5.5 Identities = 7/35 (20%), Positives = 21/35 (60%) Frame = +1 Query: 397 SSLSGFNYMFSQSMYEDLEEHLPVEIRPEWFLRNY 501 +++ G +Y + ++D++ LP+++ + +R Y Sbjct: 659 ANIEGTSYFLNDYKHKDVDVTLPLDLHIQNAIREY 693 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.8 bits (44), Expect = 7.3 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 667 KSDXHKTLYVCRKYKLLMWI 726 KS+ LYVCR +W+ Sbjct: 75 KSEKRIPLYVCRVLHTTVWV 94 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 7.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 731 CNIHIRSLYFRQTYNVL 681 CNI S F Q YN L Sbjct: 667 CNIQDMSFLFSQLYNAL 683 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 7.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 731 CNIHIRSLYFRQTYNVL 681 CNI S F Q YN L Sbjct: 757 CNIQDMSFLFSQLYNAL 773 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 237,605 Number of Sequences: 438 Number of extensions: 5606 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -