BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0136 (577 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z93387-5|CAB54299.3| 134|Caenorhabditis elegans Hypothetical pr... 30 1.0 AF068716-8|AAC17749.1| 554|Caenorhabditis elegans Innexin prote... 27 9.5 >Z93387-5|CAB54299.3| 134|Caenorhabditis elegans Hypothetical protein T02E9.5 protein. Length = 134 Score = 30.3 bits (65), Expect = 1.0 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = +2 Query: 344 ECTIRRQRPFPGLVASYAPTEGQIACSTQWSGCSD 448 + T+R + F G +A YAPT G I CS Q++ C D Sbjct: 25 DATVRDKTEFCGTMAQYAPT-GDIYCS-QFAMCCD 57 >AF068716-8|AAC17749.1| 554|Caenorhabditis elegans Innexin protein 4 protein. Length = 554 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 342 QSALSGGSGRSRDWWHHMPLLRVRSRVLRNGAAAQTPQHH 461 Q L G GR +HH ++ V + VL+N +A + H+ Sbjct: 13 QHPLISGQGRESSGYHHAAVVEVGAMVLQNMFSALSFLHY 52 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,303,164 Number of Sequences: 27780 Number of extensions: 207043 Number of successful extensions: 514 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 472 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1194789454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -