BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0132 (442 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14238| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.42 SB_56700| Best HMM Match : rve (HMM E-Value=1.1e-11) 27 5.2 >SB_14238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 799 Score = 31.1 bits (67), Expect = 0.42 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 10/58 (17%) Frame = -2 Query: 318 VNSTGKQSRTMSSEP-CIQSW*GTPCSSSCC---FV------SDCLRHL**AHPCYRC 175 VNS G S +SSEP C+Q++ G CC F+ C++H + C +C Sbjct: 641 VNSNGSLSNPLSSEPQCVQTYGGNSNVGKCCSLPFIFRDTVYDKCIKHTHTGNMCQQC 698 >SB_56700| Best HMM Match : rve (HMM E-Value=1.1e-11) Length = 1140 Score = 27.5 bits (58), Expect = 5.2 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 63 SLYADEGTAFNEILAEHLYNDVIIADYDSAVERSKLIYTDNK 188 SL D G + L+E L + +A D + K +Y D K Sbjct: 455 SLLTDHGVLYPRALSEALLFKITLATVDQGLATKKFVYPDIK 496 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,074,875 Number of Sequences: 59808 Number of extensions: 255735 Number of successful extensions: 642 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 641 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 859323430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -