BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0131 (790 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1872| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) 29 5.7 SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 >SB_1872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1801 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -1 Query: 67 HDECFKVILLL*NITISQHVCG 2 HD+ FKV L+L + ++QH CG Sbjct: 1511 HDQLFKVFLVLLDFRVTQHQCG 1532 >SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) Length = 900 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/67 (25%), Positives = 33/67 (49%) Frame = +3 Query: 357 YIMPYGDLNPGARRRHNVRVVTVGRYRMLKDMVSHKILKTKSEISALTDFLIG*RKRKEM 536 ++MP+ DL R ++ VT ++L+ ++ H + + + L+DF G RKR+ Sbjct: 456 FVMPFKDLATNNYRPVSLTSVTC---KILEHVICHHVWQHLEQHGILSDFQHGFRKRRNC 512 Query: 537 VVSFLYT 557 + T Sbjct: 513 ETQLIIT 519 >SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1383 Score = 27.9 bits (59), Expect = 9.9 Identities = 18/69 (26%), Positives = 37/69 (53%) Frame = +2 Query: 161 VTEVKSEWEAKWKRILKCLPHWLRSQSVSHQEVLSYRLGHGYNRTETNR*DMPNSSIYSE 340 +TE+ ++ + K + I++ + RS+ E L+ + +GYN + N + SS+Y E Sbjct: 440 MTEIPTKPKKKSRSIIQTILRRSRSRDKFRYEFLAAK--YGYNYKQFNHPEHKRSSLYDE 497 Query: 341 TDLFPIYYA 367 + P +Y+ Sbjct: 498 NE--PDWYS 504 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,020,485 Number of Sequences: 59808 Number of extensions: 531016 Number of successful extensions: 1229 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1229 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2167838629 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -