BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0130 (524 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56597| Best HMM Match : COesterase (HMM E-Value=0) 28 5.4 SB_44333| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 >SB_56597| Best HMM Match : COesterase (HMM E-Value=0) Length = 505 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 155 IYILIVFLVFSVCEGSLGLSILVSIIRSHGNDYFK 259 I I+I+ ++ + E + LSI+++II +DY + Sbjct: 462 IIIIIIIIIIIIIENVINLSIIINIIDVDVDDYLQ 496 >SB_44333| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +2 Query: 245 NDYFKDLEYYNDKIFIYNNFYNSFMFYKKYILIGSNNII--FYNIFVYKFK 391 +D FK++ N K + F + FY+K ++ G N YN+ Y K Sbjct: 271 SDLFKNVRLKNGKAIKWKEFVSQMNFYEK-VMQGLNRSFKSVYNVLYYNIK 320 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,210,629 Number of Sequences: 59808 Number of extensions: 62712 Number of successful extensions: 195 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 186 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 194 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1184975377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -