BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0129 (738 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 22 4.5 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 5.9 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 5.9 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 5.9 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 5.9 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 5.9 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 5.9 AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax pr... 22 5.9 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 5.9 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 301 KKNTDAMRSFSFPFIALQDVTVEQPMFSANCIKGKVR 411 + D ++ F P + +QDVT++ FS ++ K R Sbjct: 649 RNGVDTLQQFLTPNMRVQDVTIK---FSDRTVRPKQR 682 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -1 Query: 420 RLGTNFTFYTVGREHRLFHSYILQCNKRKTE*SHGICI 307 R T++T Y + FH +R+ E +H +C+ Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 259 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -1 Query: 420 RLGTNFTFYTVGREHRLFHSYILQCNKRKTE*SHGICI 307 R T++T Y + FH +R+ E +H +C+ Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 259 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -1 Query: 420 RLGTNFTFYTVGREHRLFHSYILQCNKRKTE*SHGICI 307 R T++T Y + FH +R+ E +H +C+ Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 259 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -1 Query: 420 RLGTNFTFYTVGREHRLFHSYILQCNKRKTE*SHGICI 307 R T++T Y + FH +R+ E +H +C+ Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 259 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -1 Query: 420 RLGTNFTFYTVGREHRLFHSYILQCNKRKTE*SHGICI 307 R T++T Y + FH +R+ E +H +C+ Sbjct: 178 RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 215 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -1 Query: 420 RLGTNFTFYTVGREHRLFHSYILQCNKRKTE*SHGICI 307 R T++T Y + FH +R+ E +H +C+ Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 259 >AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax protein. Length = 100 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -1 Query: 420 RLGTNFTFYTVGREHRLFHSYILQCNKRKTE*SHGICI 307 R T++T Y + FH +R+ E +H +C+ Sbjct: 10 RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 47 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -1 Query: 420 RLGTNFTFYTVGREHRLFHSYILQCNKRKTE*SHGICI 307 R T++T Y + FH +R+ E +H +C+ Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 259 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,297 Number of Sequences: 336 Number of extensions: 3347 Number of successful extensions: 13 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -