BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0127 (730 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 23 1.9 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 1.9 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 23 3.3 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 23 3.3 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 23 3.3 AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcrip... 23 3.3 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 4.4 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 7.7 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 23.4 bits (48), Expect = 1.9 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -2 Query: 336 SSPWRPAADMGT--NRXDISTYIPX*IFKAAESIRTPPQMRCSSRSEPY 196 +SP +P + T N+ ST + I+ +++ RT PQ+ S PY Sbjct: 440 NSPTKPYYKLKTANNKRPPSTELGTNIYTSSKRQRTSPQLSPMSSLPPY 488 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 461 HRXHPLPVQTRHAPVLRANPYS 396 +R HPL + + H +L NP S Sbjct: 332 NRCHPLSLSSDHQAMLHHNPMS 353 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 287 SPRTSXPEFSRPQRVSG 237 +P T+ P + +PQ +SG Sbjct: 8 NPGTALPTYQQPQHISG 24 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 287 SPRTSXPEFSRPQRVSG 237 +P T+ P + +PQ +SG Sbjct: 8 NPGTALPTYQQPQHISG 24 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 287 SPRTSXPEFSRPQRVSG 237 +P T+ P + +PQ +SG Sbjct: 8 NPGTALPTYQQPQHISG 24 >AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcription factor TcDfd1 protein. Length = 126 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 287 SPRTSXPEFSRPQRVSG 237 +P T+ P + +PQ +SG Sbjct: 8 NPGTALPTYQQPQHISG 24 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -2 Query: 138 PYLSAASSGHFGLPRRTLVFKDEG 67 P++S++ G VFKDEG Sbjct: 2 PHVSSSGGDDLGSTDEVKVFKDEG 25 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 7.7 Identities = 6/25 (24%), Positives = 16/25 (64%) Frame = +1 Query: 421 GACRVWTGSGCXRCRVWSMFVRYVR 495 G + G+GC R ++ ++++++R Sbjct: 744 GTLMMVLGTGCVRIKITGVWLKFLR 768 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,272 Number of Sequences: 336 Number of extensions: 3640 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -