BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0127 (730 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 29 0.90 SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pom... 26 6.3 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 8.4 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 28.7 bits (61), Expect = 0.90 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 445 SGCXRCRVWSMFVRYVRFSELDFNIMRPQKLYIF 546 +GC + VW +VR+V F E LY++ Sbjct: 108 NGCGKSYVWPSYVRFVDFDERYTRFANKYSLYLY 141 >SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1375 Score = 25.8 bits (54), Expect = 6.3 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = -3 Query: 230 RKCGALRVPNHISLL*DSMEXERSGRKENSSXTSRRRLQATLGYPVEHSFLK 75 +K + +P HI LL + E + + +++ + SRRR L EH LK Sbjct: 1037 QKISEMNIPGHIHLLRELEEEKSNTQRKIAHFESRRRYLTNL---YEHIVLK 1085 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 8.4 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 370 FPYLHYSID*RLFTLETCCGYGYEPXRHL 284 +P+ S+D R+F LE+ GY EP L Sbjct: 159 YPFDLDSLDKRIFKLESKIGYADEPLSEL 187 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,043,073 Number of Sequences: 5004 Number of extensions: 62199 Number of successful extensions: 174 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 174 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -