BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0124 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 24 4.4 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 24 5.8 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 5.8 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 456 PQKGNREMSPREERTFSVIGDVLDIRKIY 542 P+KGN ++ + E F VL+I +IY Sbjct: 877 PKKGNFKVKDKREFEFDPARTVLEICRIY 905 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +2 Query: 452 ETAKRQSRNVASRGEDFQRDWRCFRYKENLLCY 550 E K+Q++ V RG +RD F+ K+ Y Sbjct: 404 EQYKKQAKEVERRGNRNRRDLNAFKEKQYYEAY 436 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +2 Query: 452 ETAKRQSRNVASRGEDFQRDWRCFRYKENLLCY 550 E K+Q++ V RG +RD F+ K+ Y Sbjct: 404 EQYKKQAKEVERRGNRNRRDLNAFKEKQYYEAY 436 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 610,139 Number of Sequences: 2352 Number of extensions: 10107 Number of successful extensions: 25 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -