BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0120 (635 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y13622-1|CAA73944.1| 1587|Homo sapiens latent TGF-beta binding p... 31 2.6 AY366246-1|AAR16204.1| 239|Homo sapiens natural killer cell inh... 30 6.0 AJ620615-1|CAF05810.2| 230|Homo sapiens killer cell immunoglobu... 30 6.0 X94609-1|CAA64317.1| 304|Homo sapiens activatory NK receptor/KK... 30 7.9 U96188-1|AAB54118.1| 202|Homo sapiens p50 cell activatory recep... 30 7.9 U24077-1|AAC50336.1| 301|Homo sapiens p58 natural killer cell r... 30 7.9 L76671-1|AAB36599.1| 304|Homo sapiens protein ( Homo sapiens nk... 30 7.9 DQ371643-1|ABD38583.1| 239|Homo sapiens killer Ig receptor prot... 30 7.9 BC127084-1|AAI27085.1| 304|Homo sapiens killer cell immunoglobu... 30 7.9 BC125147-1|AAI25148.2| 284|Homo sapiens KIR2DS4 protein protein. 30 7.9 BC108918-1|AAI08919.1| 304|Homo sapiens killer cell immunoglobu... 30 7.9 BC103693-1|AAI03694.1| 304|Homo sapiens killer cell immunoglobu... 30 7.9 BC101977-1|AAI01978.1| 304|Homo sapiens killer cell immunoglobu... 30 7.9 BC096694-1|AAH96694.1| 304|Homo sapiens killer cell immunoglobu... 30 7.9 AY523803-1|AAS73159.1| 138|Homo sapiens KIR antigen 2DS4 protein. 30 7.9 AY523801-1|AAS73158.1| 138|Homo sapiens KIR antigen 2DS4 protein. 30 7.9 AY523799-1|AAS73157.1| 152|Homo sapiens KIR antigen 2DS4 protein. 30 7.9 AY388472-1|AAR26325.1| 304|Homo sapiens natural killer cell Ig-... 30 7.9 AY366245-1|AAR16203.1| 304|Homo sapiens natural killer cell inh... 30 7.9 AY102623-1|AAM52329.1| 222|Homo sapiens KIR1D splice variant pr... 30 7.9 AJ620616-1|CAF05811.2| 230|Homo sapiens killer cell immunoglobu... 30 7.9 AJ417555-1|CAD10379.1| 297|Homo sapiens killer cell immunoglobu... 30 7.9 AJ417554-1|CAD10378.1| 232|Homo sapiens killer cell immunoglobu... 30 7.9 AF135562-1|AAD48770.1| 203|Homo sapiens p58 killer cell inhibit... 30 7.9 AF135559-1|AAD48767.1| 203|Homo sapiens p58 killer cell inhibit... 30 7.9 AF135556-1|AAD48764.1| 203|Homo sapiens p58 killer cell inhibit... 30 7.9 AF051345-1|AAC39880.2| 1624|Homo sapiens latent transforming gro... 30 7.9 AF051344-1|AAC39879.2| 1557|Homo sapiens latent transforming gro... 30 7.9 AF002255-1|AAB61281.1| 304|Homo sapiens cl-17 protein. 30 7.9 >Y13622-1|CAA73944.1| 1587|Homo sapiens latent TGF-beta binding protein-4 protein. Length = 1587 Score = 31.5 bits (68), Expect = 2.6 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 247 P*SESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEPRCC 381 P E R P GP LP+ ++ T +P + PSS P+ C Sbjct: 475 PRPEPRPDPRPGPELPLPSIPAWTGPEIPESGPSSGMCQRNPQVC 519 >AY366246-1|AAR16204.1| 239|Homo sapiens natural killer cell inhibitory receptor protein. Length = 239 Score = 30.3 bits (65), Expect = 6.0 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 86 SIGPMMPVLAGTYRCYSSVPHS-PYQLSAPSDP 117 >AJ620615-1|CAF05810.2| 230|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 230 Score = 30.3 bits (65), Expect = 6.0 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 77 SIGPMMPVLAGTYRCYSSVPHS-PYQLSAPSDP 108 >X94609-1|CAA64317.1| 304|Homo sapiens activatory NK receptor/KKA3 p50.3 protein. Length = 304 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 86 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >U96188-1|AAB54118.1| 202|Homo sapiens p50 cell activatory receptor NKR-K1 protein. Length = 202 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 65 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 96 >U24077-1|AAC50336.1| 301|Homo sapiens p58 natural killer cell receptor precursor protein. Length = 301 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 83 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 114 >L76671-1|AAB36599.1| 304|Homo sapiens protein ( Homo sapiens nkat8 mRNA, complete cds. ). Length = 304 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 86 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >DQ371643-1|ABD38583.1| 239|Homo sapiens killer Ig receptor protein. Length = 239 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 86 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >BC127084-1|AAI27085.1| 304|Homo sapiens killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, protein. Length = 304 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 86 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >BC125147-1|AAI25148.2| 284|Homo sapiens KIR2DS4 protein protein. Length = 284 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 79 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 110 >BC108918-1|AAI08919.1| 304|Homo sapiens killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, protein. Length = 304 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 86 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >BC103693-1|AAI03694.1| 304|Homo sapiens killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, protein. Length = 304 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 86 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >BC101977-1|AAI01978.1| 304|Homo sapiens killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, protein. Length = 304 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 86 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >BC096694-1|AAH96694.1| 304|Homo sapiens killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, protein. Length = 304 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 86 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >AY523803-1|AAS73159.1| 138|Homo sapiens KIR antigen 2DS4 protein. Length = 138 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 21 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 52 >AY523801-1|AAS73158.1| 138|Homo sapiens KIR antigen 2DS4 protein. Length = 138 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 21 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 52 >AY523799-1|AAS73157.1| 152|Homo sapiens KIR antigen 2DS4 protein. Length = 152 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 35 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 66 >AY388472-1|AAR26325.1| 304|Homo sapiens natural killer cell Ig-like receptor KIR2DS4 protein. Length = 304 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 86 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >AY366245-1|AAR16203.1| 304|Homo sapiens natural killer cell inhibitory receptor protein. Length = 304 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 86 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >AY102623-1|AAM52329.1| 222|Homo sapiens KIR1D splice variant protein. Length = 222 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 86 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 >AJ620616-1|CAF05811.2| 230|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 230 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 77 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 108 >AJ417555-1|CAD10379.1| 297|Homo sapiens killer cell immunoglobulin receptor protein. Length = 297 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 79 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 110 >AJ417554-1|CAD10378.1| 232|Homo sapiens killer cell immunoglobulin receptor protein. Length = 232 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 79 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 110 >AF135562-1|AAD48770.1| 203|Homo sapiens p58 killer cell inhibitory receptor KIR-K78 protein. Length = 203 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 65 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 96 >AF135559-1|AAD48767.1| 203|Homo sapiens p58 killer cell inhibitory receptor KIR-K61 protein. Length = 203 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 65 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 96 >AF135556-1|AAD48764.1| 203|Homo sapiens p58 killer cell inhibitory receptor KIR-K15 protein. Length = 203 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 65 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 96 >AF051345-1|AAC39880.2| 1624|Homo sapiens latent transforming growth factor-beta binding protein 4L protein. Length = 1624 Score = 29.9 bits (64), Expect = 7.9 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +1 Query: 247 P*SESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEPRCC 381 P E R P GP P+ ++ T +P + PSS P+ C Sbjct: 512 PRPEPRPDPRPGPEFPLPSIPAWTGPEIPESGPSSGMCQRNPQVC 556 >AF051344-1|AAC39879.2| 1557|Homo sapiens latent transforming growth factor-beta binding protein 4S protein. Length = 1557 Score = 29.9 bits (64), Expect = 7.9 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +1 Query: 247 P*SESRRAPSAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEPRCC 381 P E R P GP P+ ++ T +P + PSS P+ C Sbjct: 445 PRPEPRPDPRPGPEFPLPSIPAWTGPEIPESGPSSGMCQRNPQVC 489 >AF002255-1|AAB61281.1| 304|Homo sapiens cl-17 protein. Length = 304 Score = 29.9 bits (64), Expect = 7.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 274 SAGPMLPVAAVTRRTSRTVPHTYPSSVTLNSEP 372 S GPM+PV A T R +VPH+ P ++ S+P Sbjct: 86 SIGPMMPVLAGTYRCYGSVPHS-PYQLSAPSDP 117 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,402,329 Number of Sequences: 237096 Number of extensions: 1767660 Number of successful extensions: 4748 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 4550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4746 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6972732040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -