BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0120 (635 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70208-1|CAA94141.1| 339|Caenorhabditis elegans Hypothetical pr... 29 2.1 U41270-3|ABC71846.1| 254|Caenorhabditis elegans Hypothetical pr... 28 4.9 >Z70208-1|CAA94141.1| 339|Caenorhabditis elegans Hypothetical protein F54B11.1 protein. Length = 339 Score = 29.5 bits (63), Expect = 2.1 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 5/60 (8%) Frame = -3 Query: 321 RGASSHRRYRQHGSSGWRSP-----ALASRKHFLFICVEPGSTPRCPSGTPSMSPQKGSP 157 RG ++ R ++ ++GWRSP +AS C PG P PSG P + G P Sbjct: 104 RGYNTGYRSQKKKNNGWRSPPRSGIVVASEGGTCMGCCNPG--PPGPSGHPGKPGRPGRP 161 >U41270-3|ABC71846.1| 254|Caenorhabditis elegans Hypothetical protein AH9.3 protein. Length = 254 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 222 EPGSTPRCPSGTPSMSPQKGSPDTSARQNKV 130 E GS+P+ + T P+K S D +A +N+V Sbjct: 44 EAGSSPKATTTTDGEVPEKDSADENAEKNQV 74 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,988,070 Number of Sequences: 27780 Number of extensions: 284219 Number of successful extensions: 851 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1406256614 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -