BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0118 (741 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0042 - 334417-334431,334563-334688,334852-335136,335220-33... 29 2.9 >07_01_0042 - 334417-334431,334563-334688,334852-335136,335220-335368, 336239-336536,337030-337131,337245-337613,337973-338115, 338334-338518,339246-339475,339734-339821,340158-340253, 340397-340512,340604-340852,340950-341175,341411-341622 Length = 962 Score = 29.5 bits (63), Expect = 2.9 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -3 Query: 547 HFIWTVLDIGYVSDIEIITTEKN*LFYFYW-FTFA*NISH 431 H+I VL IG + ++T E N L +YW T N+SH Sbjct: 520 HYISEVLQIGENDSVIVMTHEPNWLLDWYWKETTGKNVSH 559 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,989,242 Number of Sequences: 37544 Number of extensions: 372656 Number of successful extensions: 635 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -