BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0117 (807 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32406| Best HMM Match : VWA (HMM E-Value=8.8e-32) 33 0.21 SB_42639| Best HMM Match : Homeobox (HMM E-Value=1e-26) 29 4.4 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 29 4.4 SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_32406| Best HMM Match : VWA (HMM E-Value=8.8e-32) Length = 1074 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -2 Query: 317 VLPHRRRCQPKRGRSGIREGQGLMQPLPGLVQGINSITNSQTIT 186 ++P RR + R GIR G+G P P +V +N IT ++ +T Sbjct: 544 IIPSRRPGKRPGPRPGIRPGRGGRIPKPAVVYPLNGITGARDVT 587 >SB_42639| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 225 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +2 Query: 206 LSN*YPAPNLEVVASNLALHEY 271 L N YP+ NL+VV SN++L+ Y Sbjct: 204 LPNFYPSSNLQVVYSNMSLYPY 225 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +2 Query: 206 LSN*YPAPNLEVVASNLALHEY 271 L N YP+ NL+VV SN++L+ Y Sbjct: 1043 LPNFYPSSNLQVVYSNMSLYPY 1064 >SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -2 Query: 215 NSITNSQTITAVTWHSSS 162 +S++ S TITA+ WH SS Sbjct: 288 HSVSQSDTITAIAWHPSS 305 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,707,154 Number of Sequences: 59808 Number of extensions: 538540 Number of successful extensions: 1238 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1237 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2239700683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -