BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0115 (769 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY659929-1|AAT51797.1| 140|Anopheles gambiae lysozyme c-2 protein. 33 0.013 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 7.9 >AY659929-1|AAT51797.1| 140|Anopheles gambiae lysozyme c-2 protein. Length = 140 Score = 32.7 bits (71), Expect = 0.013 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 31 IIFALVVLCVGSEAKTFTRCGLVHELRKHGFEENLM 138 ++ A+ C EAKTFT+C LV + G + L+ Sbjct: 7 VLIAIAASCSVGEAKTFTKCELVKAMYNRGISKKLL 42 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.4 bits (48), Expect = 7.9 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 25 KLIIFALVVLCVGSEAKTFTRCGLVHELRKHG 120 K I A + + +G A RC + +L KHG Sbjct: 120 KSAILAAMTIGLGCNAGQTNRCSSLKDLIKHG 151 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 732,878 Number of Sequences: 2352 Number of extensions: 15024 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -