BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0111 (766 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1ZFM9 Cluster: Collagenase, putative; n=1; Microscilla... 33 5.9 UniRef50_A5L2V1 Cluster: Putative uncharacterized protein; n=1; ... 33 7.8 >UniRef50_A1ZFM9 Cluster: Collagenase, putative; n=1; Microscilla marina ATCC 23134|Rep: Collagenase, putative - Microscilla marina ATCC 23134 Length = 964 Score = 33.5 bits (73), Expect = 5.9 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = +1 Query: 592 SN*GGDHQVSVHGLNRLIFYTXLGSGRIWLYKEHGTS 702 +N G V +H +N ++YT G+GR++ + ++G++ Sbjct: 694 NNFSGVEDVEIHPINGKVYYTSKGNGRVYRFNDNGST 730 >UniRef50_A5L2V1 Cluster: Putative uncharacterized protein; n=1; Vibrionales bacterium SWAT-3|Rep: Putative uncharacterized protein - Vibrionales bacterium SWAT-3 Length = 343 Score = 33.1 bits (72), Expect = 7.8 Identities = 20/46 (43%), Positives = 27/46 (58%) Frame = +1 Query: 334 LTLV*FIYNKTLFSNLRLKTFILHSYRKVPVYLFRDINETSERWLK 471 +TLV IYN + + LK++I HS V + +DI TSER LK Sbjct: 199 ITLVFLIYNFSTERDFSLKSYISHSKAHVNLEEKKDIPVTSERELK 244 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 789,582,449 Number of Sequences: 1657284 Number of extensions: 16337766 Number of successful extensions: 38279 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 36623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38195 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 63792713725 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -