Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0111
         (766 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF426244-1|ABO26487.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426243-1|ABO26486.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426242-1|ABO26485.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426241-1|ABO26484.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426239-1|ABO26482.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426238-1|ABO26481.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426237-1|ABO26480.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426236-1|ABO26479.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426235-1|ABO26478.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426234-1|ABO26477.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426233-1|ABO26476.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426232-1|ABO26475.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426231-1|ABO26474.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426230-1|ABO26473.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426229-1|ABO26472.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426228-1|ABO26471.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426227-1|ABO26470.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426226-1|ABO26469.1|   64|Anopheles gambiae unknown protein.         24   4.5  
EF426225-1|ABO26468.1|   64|Anopheles gambiae unknown protein.         24   4.5  
AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh...    24   4.5  

>EF426244-1|ABO26487.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426243-1|ABO26486.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426242-1|ABO26485.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426241-1|ABO26484.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426239-1|ABO26482.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426238-1|ABO26481.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426237-1|ABO26480.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426236-1|ABO26479.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426235-1|ABO26478.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426234-1|ABO26477.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426233-1|ABO26476.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426232-1|ABO26475.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426231-1|ABO26474.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426230-1|ABO26473.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426229-1|ABO26472.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426228-1|ABO26471.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426227-1|ABO26470.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426226-1|ABO26469.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>EF426225-1|ABO26468.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = +2

Query: 746 WWWVIW 763
           WWWV+W
Sbjct: 26  WWWVLW 31


>AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative
           cell-adhesion protein protein.
          Length = 1881

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +1

Query: 298 H*CVHQGHHKLDLTLV*FIYNKTLFSNLRLKTFILHSYRKVPVYLFRDINET 453
           H C+  G H     ++  I + TL S  R   F++  + ++ + L R+  ET
Sbjct: 27  HRCLLAGSHSFTQLVLCLILSATLVSCNRAPVFLIDDHAEIVIRL-REFPET 77


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 833,130
Number of Sequences: 2352
Number of extensions: 17615
Number of successful extensions: 51
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 47
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 79418373
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)