BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fbpv0111
(766 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF426244-1|ABO26487.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426243-1|ABO26486.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426242-1|ABO26485.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426241-1|ABO26484.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426239-1|ABO26482.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426238-1|ABO26481.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426237-1|ABO26480.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426236-1|ABO26479.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426235-1|ABO26478.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426234-1|ABO26477.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426233-1|ABO26476.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426232-1|ABO26475.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426231-1|ABO26474.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426230-1|ABO26473.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426229-1|ABO26472.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426228-1|ABO26471.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426227-1|ABO26470.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426226-1|ABO26469.1| 64|Anopheles gambiae unknown protein. 24 4.5
EF426225-1|ABO26468.1| 64|Anopheles gambiae unknown protein. 24 4.5
AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 24 4.5
>EF426244-1|ABO26487.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426243-1|ABO26486.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426242-1|ABO26485.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426241-1|ABO26484.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426239-1|ABO26482.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426238-1|ABO26481.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426237-1|ABO26480.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426236-1|ABO26479.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426235-1|ABO26478.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426234-1|ABO26477.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426233-1|ABO26476.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426232-1|ABO26475.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426231-1|ABO26474.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426230-1|ABO26473.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426229-1|ABO26472.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426228-1|ABO26471.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426227-1|ABO26470.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426226-1|ABO26469.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>EF426225-1|ABO26468.1| 64|Anopheles gambiae unknown protein.
Length = 64
Score = 24.2 bits (50), Expect = 4.5
Identities = 5/6 (83%), Positives = 6/6 (100%)
Frame = +2
Query: 746 WWWVIW 763
WWWV+W
Sbjct: 26 WWWVLW 31
>AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative
cell-adhesion protein protein.
Length = 1881
Score = 24.2 bits (50), Expect = 4.5
Identities = 14/52 (26%), Positives = 25/52 (48%)
Frame = +1
Query: 298 H*CVHQGHHKLDLTLV*FIYNKTLFSNLRLKTFILHSYRKVPVYLFRDINET 453
H C+ G H ++ I + TL S R F++ + ++ + L R+ ET
Sbjct: 27 HRCLLAGSHSFTQLVLCLILSATLVSCNRAPVFLIDDHAEIVIRL-REFPET 77
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 833,130
Number of Sequences: 2352
Number of extensions: 17615
Number of successful extensions: 51
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 47
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 79418373
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -