BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0111 (766 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69636-2|CAA93463.3| 247|Caenorhabditis elegans Hypothetical pr... 29 4.8 Z81134-7|CAD56602.1| 879|Caenorhabditis elegans Hypothetical pr... 28 6.3 Z81134-6|CAB03450.2| 795|Caenorhabditis elegans Hypothetical pr... 28 6.3 AL117202-32|CAD56611.1| 879|Caenorhabditis elegans Hypothetical... 28 6.3 AL117202-31|CAD56610.1| 795|Caenorhabditis elegans Hypothetical... 28 6.3 >Z69636-2|CAA93463.3| 247|Caenorhabditis elegans Hypothetical protein F20B10.3 protein. Length = 247 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +1 Query: 184 SLSN*YPAPNLEVVASNHCPSRIPISLSSAXTDACG 291 S N P P L AS +C S P+ S T CG Sbjct: 55 STGNCQPTPTLSPCASGNCGSVQPVQASPCSTGNCG 90 >Z81134-7|CAD56602.1| 879|Caenorhabditis elegans Hypothetical protein T28D6.5b protein. Length = 879 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 227 HQTIALHEYRSPSLRLXPTPVGQNISVFIK 316 ++ + + Y SP + PTP + SVFIK Sbjct: 90 YECVCMRPYSSPHSPVRPTPAAPDCSVFIK 119 >Z81134-6|CAB03450.2| 795|Caenorhabditis elegans Hypothetical protein T28D6.5a protein. Length = 795 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 227 HQTIALHEYRSPSLRLXPTPVGQNISVFIK 316 ++ + + Y SP + PTP + SVFIK Sbjct: 90 YECVCMRPYSSPHSPVRPTPAAPDCSVFIK 119 >AL117202-32|CAD56611.1| 879|Caenorhabditis elegans Hypothetical protein T28D6.5b protein. Length = 879 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 227 HQTIALHEYRSPSLRLXPTPVGQNISVFIK 316 ++ + + Y SP + PTP + SVFIK Sbjct: 90 YECVCMRPYSSPHSPVRPTPAAPDCSVFIK 119 >AL117202-31|CAD56610.1| 795|Caenorhabditis elegans Hypothetical protein T28D6.5a protein. Length = 795 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 227 HQTIALHEYRSPSLRLXPTPVGQNISVFIK 316 ++ + + Y SP + PTP + SVFIK Sbjct: 90 YECVCMRPYSSPHSPVRPTPAAPDCSVFIK 119 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,231,275 Number of Sequences: 27780 Number of extensions: 391489 Number of successful extensions: 891 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 891 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1830096852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -