BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0108 (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 27 0.63 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 27 0.63 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 25 3.3 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 23 7.7 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 27.1 bits (57), Expect = 0.63 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 582 DPVSPCGRPFLLVRTFNAQVL 520 DP+ C R + RTF AQ+L Sbjct: 123 DPLDNCARAYYAFRTFRAQIL 143 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 27.1 bits (57), Expect = 0.63 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +1 Query: 424 QQRQDQFKSQLEIHSAVGEQQGLLQDREPERKQNLGIESPN*QKWAT 564 QQ+Q Q + Q + +QQ Q + ++ Q ++ P Q W T Sbjct: 191 QQQQQQQQQQQQQQQQQRQQQQQCQQQRQQQPQQQQLQQPQQQLWTT 237 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 24.6 bits (51), Expect = 3.3 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +3 Query: 195 NKGELITNVVNNLXRNNKMNAWSTPTSSGCKAPRTSSGIVSRLSS 329 N+G TN NN NN N +T S A ++S +++ +S Sbjct: 91 NEGTGKTNNNNNNNNNNGSNTGATVNSGSSNAALSNSSVLNGSNS 135 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 23.4 bits (48), Expect = 7.7 Identities = 18/70 (25%), Positives = 32/70 (45%) Frame = +2 Query: 227 QSDXKQQDERMEYAYQLWMQGSEDIVRDCFPVEFTLILAENYVKLMYRRDGLAFTLSDNG 406 Q K QD R++ A + +D+V + +LA + +L+ + L T+SD Sbjct: 258 QEIQKAQD-RLKNAQKALKDAKKDVVT---AKDEKSVLATEHQQLLREKTKLDLTISDLS 313 Query: 407 GVAYGDSKDR 436 GD+K + Sbjct: 314 DEVQGDNKSK 323 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 741,087 Number of Sequences: 2352 Number of extensions: 15239 Number of successful extensions: 31 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -