BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0106 (687 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 2.3 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 2.3 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 2.3 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 2.3 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 2.3 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 2.3 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 2.3 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 2.3 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 2.3 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 9.5 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 21 9.5 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 680 PPMSMFSTASATVTSGLRYP 621 PP+S S ++AT +SGL P Sbjct: 127 PPLSTPSNSNATKSSGLTSP 146 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 680 PPMSMFSTASATVTSGLRYP 621 PP+S S ++AT +SGL P Sbjct: 127 PPLSTPSNSNATKSSGLTSP 146 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 680 PPMSMFSTASATVTSGLRYP 621 PP+S S ++AT +SGL P Sbjct: 127 PPLSTPSNSNATKSSGLTSP 146 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 680 PPMSMFSTASATVTSGLRYP 621 PP+S S ++AT +SGL P Sbjct: 127 PPLSTPSNSNATKSSGLTSP 146 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 680 PPMSMFSTASATVTSGLRYP 621 PP+S S ++AT +SGL P Sbjct: 127 PPLSTPSNSNATKSSGLTSP 146 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 680 PPMSMFSTASATVTSGLRYP 621 PP+S S ++AT +SGL P Sbjct: 83 PPLSTPSNSNATKSSGLTSP 102 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 680 PPMSMFSTASATVTSGLRYP 621 PP+S S ++AT +SGL P Sbjct: 127 PPLSTPSNSNATKSSGLTSP 146 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 680 PPMSMFSTASATVTSGLRYP 621 PP+S S ++AT +SGL P Sbjct: 127 PPLSTPSNSNATKSSGLTSP 146 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 680 PPMSMFSTASATVTSGLRYP 621 PP+S S ++AT +SGL P Sbjct: 127 PPLSTPSNSNATKSSGLTSP 146 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.0 bits (42), Expect = 9.5 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = -1 Query: 480 PSISGALVMSDTS*TVRPAFRSARGGTATGNQLQATF 370 PS++ A + D+ ++P + G T++ AT+ Sbjct: 174 PSVTAAPHLRDSPNYIKPQLHVSTGSTSSPTIASATY 210 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +3 Query: 219 YNNRLSPPVNPSQVSYTVVLEQTEH 293 Y+N P VSY+ V++ H Sbjct: 52 YHNNPRDPNRARSVSYSTVIQSVPH 76 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,968 Number of Sequences: 336 Number of extensions: 3023 Number of successful extensions: 12 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -