BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0106 (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 25 1.7 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 23 6.8 DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. 23 6.8 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 9.0 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 25.4 bits (53), Expect = 1.7 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -2 Query: 467 VLS*CPTHLEL*GRRSEAPVAVPPLAINCRPHSDRLFANESRPV 336 VL CP +L GR +APV +PP + DR+ E P+ Sbjct: 81 VLVCCPLVRKLTGR-FDAPVELPPPGECGKMQMDRIVGGEVAPI 123 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 23.4 bits (48), Expect = 6.8 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Frame = +1 Query: 370 ECGLQLIASGGT----ATGASERRPHSSRCVGHHESTGDARRSGENFTSSV 510 E GLQ+ A + A G RRP R + HH R + E+ +S+ Sbjct: 84 ELGLQVSAKTVSRRLHAAGFCARRPRKVRKLQHHHVEARIRFAEEHLAASI 134 >DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. Length = 304 Score = 23.4 bits (48), Expect = 6.8 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +1 Query: 307 KLALLSVSDKTGLLSLAKSLSECGLQLIASGGTATGASERR 429 KL + +D T +SLA LSEC L +I S E R Sbjct: 13 KLEAMVANDST--VSLAPVLSECLLNVIFSTTLGANVVEER 51 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +3 Query: 564 SEVRDDKRGGL*PVPVSS 617 SEV D GGL PVP++S Sbjct: 622 SEVNDFFYGGLEPVPLAS 639 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 647,891 Number of Sequences: 2352 Number of extensions: 12984 Number of successful extensions: 27 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -